Jesse Metcalfe dating

Jesse Metcalfe cruises in for a cozy lunch date with a mystery woman in a classic muscle car

2020.10.17 08:39 templederr Jesse Metcalfe cruises in for a cozy lunch date with a mystery woman in a classic muscle car

Jesse Metcalfe cruises in for a cozy lunch date with a mystery woman in a classic muscle car submitted by templederr to trendandstyle [link] [comments]


2020.10.04 05:05 twhite56 Week 4 Recap Report

I'm creating this to keep people up to date on fantasy football standings.
Top quarterbacks of week 4: RKNAMECMPATTPCTPS YDPS TDINTRU YDSRU TDPTS --::----:--:--:--:--:--:--:--:--: 1Patrick Mahomes314273.83854026140 2Russell Wilson274067.53155022036.8 3Josh Allen243372.7311418131.2 4Dak Prescott375764.94723226027.5 5Jared Goff233271.9321214127.2 6Aaron Rodgers213265.62833012024.5 7Ryan Fitzpatrick1820901602038124.2 8Tom Brady253865.8297300023.9 9Drew Brees293680.6288300023.5 10Kyler Murray233565.72702329121.7 11Carson Wentz294761.72251265121.5 12​Joe Burrow314470.531220-1020.4
Top running backs of week 4: RKNAMEATTYDSAVGTDTGTSRECYDSTDFUM LSTPTS --::----:--:--:--:--:--:--:--:--:--: 1Alvin Kamara6589.7014131392038.2 2Rex Burkhead6498.22107491031.3 3James Robinson11464.2266830027.9 4Derrick Henry261194.6232110026 5Austin Ekeler12594.911111840025.8 6Dalvin Cook221818.2152180124.9 7Nick Chubb191085.721120023.5 8James Conner181096.1154400022.9 9Jeff Wilson Jr.12151.2133541020.4 10Mike Davis13463.5098451019.1 11Darrell Henderson Jr.201145.713160018.5 12Clyde Edwards-Helaire20643.2065700015.9 13Aaron Jones16694.3142170015.6 14Jerick McKinnon14382.7143390015.2 15Sony Michel911713022230015 16Ezekiel Elliott14342.41116240014.8 17Todd Gurley II14805.712120014.7 18Brian Hill9586.4131220014.5 19Devin Singletary13715.5054500014.1 20Kareem Hunt16462.9032181013.4 21Jonathan Taylor13594.511130012.7 21Miles Sanders18955.3084120012.7 23Myles Gaskin22663055290012 24David Johnson13231.8132230011.6
Top wide recievers of week 4: RKNAMETGTSRCRC YDSRC TDYD/RCRU ATTRU YDSYD/RURU TDFUM LSTPTS --::----:--:--:--:--:--:--:--:--:--:--: 1Tyler Lockett139100311.10000028 2Justin Jefferson971751250000023.5 3Cedrick Wilson75107221.40000022.7 4Allen Lazard86146124.31-2-20020.4 5Michael Gallup961381230000019.8 6Allen Robinson II1310123112.30000018.3 7Keenan Allen1913132110.20000117.2 8Cooper Kupp109107111.90000016.7 9Robert Woods6574114.8330100016.4 10Tyreek Hill6577115.422512.50016.2 11Andy Isabella4447211.81-6-60016.1 11Brandon Aiyuk857001433110.31016.1 13Tee Higgins9540280000016 14Dontrelle Inman6338212.70000015.8 15Randall Cobb4495123.80000015.5 16DK Metcalf84110127.50000115 17Hunter Renfrow96841140000014.4 18Mecole Hardman6481120.20000014.1 19DeAndre Hopkins1210137013.70000013.7 20Greg Ward11872191-6-60012.6 21Tyler Boyd1310125012.50000012.5 22Chris Godwin6564112.80000012.4 22Braxton Berrios44641160000012.4 24JuJu Smith-Schuster5443110.80000012.3
Top tight ends of week 4: RKNAMETGTSRCRC YDSRC TDYD/RCRU ATTRU YDSYD/RURU TDFUM LSTPTS --::----:--:--:--:--:--:--:--:--:--:--: 1Jimmy Graham106602100000021 2Tyler Kroft5424260000016.4 3Eric Ebron7552110.40000013.7 4Robert Tonyan55501100000013.5 5Mo Alie-Cox3350116.70000012.5 6Travis Kelce7687014.50000011.7 7Zach Ertz107700100000010.5 8Jesse James432819.30000010.3 9Foster Moreau2225112.5000009.5 T10Jacob Hollister21111000008.6 T10Greg Olsen6561012.2000008.6 T10Jonnu Smith8561012.2000008.6
Season Standings: QB TE --::----:--:--::----:--: RKNAMEPTS/GMPTSRKNAMEPTS/GMPTS 1Russell Wilson341021Noah Fant11.445.4 2Josh Allen31.393.922Travis Kelce15.145.2 3Patrick Mahomes29.387.923Jonnu Smith14.242.6 4Dak Prescott28.384.924Tyler Higbee12.838.4 5Kyler Murray26.780.145Mike Gesicki11.835.5 6Aaron Rodgers24.773.986Jimmy Graham11.133.3 7Cam Newton23.871.467Darren Waller10.631.9 8Matt Ryan21.363.848T.J. Hockenson9.929.6 9Jared Goff20.661.729Mo Alie-Cox9.729.1 10Joe Burrow20.461.2410Hunter Henry9.528.6 11Ben Roethlisberger19.859.4811Hayden Hurst9.227.6 12Lamar Jackson19.759.2412Mark Andrews9.127.4
WR RB
RK NAME PTS/GM PTS RK NAME PTS/GM PTS
1 Calvin Ridley 23.3 70 1 Alvin Kamara 31.1 93.3
2 Tyler Lockett 20.6 61.9 2 Aaron Jones 24.9 74.8
3 DeAndre Hopkins 17.2 51.7 3 Dalvin Cook 20.8 62.3
4 DK Metcalf 17 51.1 4 Ezekiel Elliott 20.1 60.2
5 Tyreek Hill 19.2 57.6 5 Melvin Gordon III 15 60.1
6 Stefon Diggs 16.9 50.8 6 James Robinson 19 56.9
7 Allen Lazard 15.2 45.6 7 Nick Chubb 18.1 54.4
8 JuJu Smith-Schuster 14.7 44.1 8 Josh Jacobs 17.9 53.7
9 Robert Woods 14.5 43.4 9 Austin Ekeler 17.3 51.8
10 Robby Anderson 14.8 44.5 10 Christian McCaffrey 24.9 49.8
11 Adam Thielen 13.3 39.8 T11 Derrick Henry 16.3 49
12 Keenan Allen 14.6 43.8 T11 Chris Carson 16.3 49
13 Terry McLaurin 13.7 41.2 13 Kareem Hunt 15.5 46.6
14 Tim Patrick 10.2 40.9 14 Clyde Edwards-Helaire 15.2 45.7
15 Mike Evans 19.8 39.7 15 James Conner 14.9 44.7
16 Davante Adams 12 36.1 16 Jonathan Taylor 14.2 42.6
17 Tyler Boyd 14.2 42.5 17 Rex Burkhead 13.8 41.4
18 Amari Cooper 12.2 36.5 18 Jerick McKinnon 13.6 40.8
19 Allen Robinson II 9.2 36.9 18 Raheem Mostert 20.4 40.8
20 Cooper Kupp 13.2 39.5 20 Darrell Henderson Jr. 12.7 38.2
21 Jerry Jeudy 12.6 37.9 21 David Johnson 12 36
22 Justin Jefferson 11.6 34.8 22 David Montgomery 11.5 34.5
23 Michael Gallup 12.6 37.7 23 Todd Gurley II 11.2 33.5
24 Julian Edelman 11.9 35.6 24 Kenyan Drake 10.8 32.4
submitted by twhite56 to u/twhite56 [link] [comments]


2020.08.03 07:07 tiny_doughnut AFLW Sign and Trade: Master Post

Hi everyone!
Going to keep an eye on incoming signings and list changes as we go along, don’t hesitate to post any articles that you see and give me a poke if I haven’t updated!
Hope you’re all staying safe and well, and we’ll be back at Ikon Park for season 2021 soon 🍩❤️
Points worth remembering for this trade period:
Day 1 Wrap Day 2 Wrap Day 3 Wrap Day 4 Wrap Day 5 Wrap Day 6 Wrap Day 7 Wrap Day 8 Wrap

Adelaide Crows:

Signed: ✅ - Najwa Allen, 1yr - Sarah Allen, until 2021 - Chelsea Biddell, 1yr - Hannah Button, 1yr - Ailish Considine, 1yr - Dayna Cox, 1yr - Angela Foley, until 2021 - Renee Forth, 1yr - Nikki Gore, 1yr - Caitlin Gould, 1yr - Anne Hatchard, until 2021 - Eloise Jones, until 2021 - Ebony Marinoff, until 2021 - Montana McKinnon, 1yr - Rhiannon Metcalfe, 1yr - Justine Mules, 1yr - Hannah Munyard, 1yr? - Maddi Newman, 1yr - Erin Phillips, 1yr - Danielle Ponter, 1yr - Marijana Rajcic, until 2021 - Chelsea Randall, until 2021 - Chloe Scheer, until 2021 - Jess Sedunary, 1yr? - Stevie-Lee Thompson, until 2021 - Deni Varnhagen, until 2021 - Lisa Whiteley, 1yr?
Movements: 🔄
Delisted: ✴️ - Nicole Campbell (delisted) - Courtney Cramey (retired) - Jess Foley (retired) - Courtney Gum (retired) - Sophie Li (retired) - Maisie Nankivell, (step away/Suncorp Super Netball) - Jaimi Tabb (delisted) - Ruth Wallace (step away)

Brisbane Lions:

Signed: ✅ - Ally Anderson, until 2022 - Lauren Arnell, 1yr - Emily Bates, until 2022 - Greta Bodey, 2yrs - Shannon Campbell, 2yrs - Gabby Collingwood, 1yr - Sophie Conway, until 2021 - Dakota Davidson, 2yrs - Belle Dawes, 2yrs - Jade Ellenger, 1yr - Nat Grider, 2yrs - Tahlia Hickie, 2yrs - Courtney Hodder, 1yr (Rookie) - Jesse Keeffe, 1yr - Breanna Koenen, 2yrs - Rheanne Lugg, 2yrs - Kate Lutkins, until 2022 - Maria Moloney, 2yrs - Orla O’Dwyer, 1yr (Rookie) - Lily Postlethwaite, 2yrs - Selina Priest, 1yr - Taylor Smith, 1yr - Cathy Svarc, 2yrs - Jesse Wardlaw, 2yrs - Sharni Webb, 1yr - Jess Wuetschner, until 2022 - Jordan Zanchetta, 1yr - Emma Zielke, 1yr
Movements: 🔄
Delisted: ✴️ - Arianna Clarke (released/stepping away) - Hannah Hillman (delisted) - Brianna McFarlane (delisted)

Carlton Blues:

Signed: ✅ - Lauren Brazzale, 1yr - Alison Downie, 1yr - Jess Edwards, 1yr - Grace Egan, until 2022 - Georgia Gee, until 2022 - Serena Gibbs, 2yrs - Maddy Guerin, 2yrs - Charlotte Hammans, 1yr - Kerryn Harrington, until 2022 - Courtney Jones, 1yr - Mua Laloifi, 2yrs - Katie Loynes, 1yr - Lucy McEvoy, until 2022 - Breann Moody, 2yrs - Elise O’Dea, 2yrs - Natalie Plane, 2yrs - Maddy Prespakis, until 2022 - Brooke Vernon, 2yrs - Brooke Walker, 1yr - Charlotte Wilson, 2yrs
Movements: 🔄 - Sarah Hosking to Richmond - Jayde Van Dyk to St Kilda - Chloe Dalton to Inactive List for 2021, has signed with the club for 2022
Delistings: ✴️ - Joanne Doonan (delisted) - Emerson Woods (delisted) - Katie Harrison (delisted) - Sharnie Whiting (delisted)

Collingwood Magpies:

Signed: ✅ - Sophie Alexander, 1yr - Jordyn Allen, until 2021 - Britt Bonnici, 1yr - Ash Brazill, until 2021 - Lauren Butler, 1yr? - Mikala Cann, 1yr? - Sophie Casey, 1yr - Steph Chiocci, 1yr? - Bri Davey, 1yr - Abbey Green, 1yr - Jaimee Lambert, 1yr - Sharni Layton, 1yr - Stacey Livingstone, 1yr - Jordan Membrey, 1yr - Chloe Molloy, until 2021 - Aliesha Newman, 1yr - Ebony O’Dea, 1yr - Alana Porter, 1yr? - Imogen Purcell, 1yr, Category B Rookie - Sarah Rowe, 1yr - Ruby Schleicher, until 2021 - Aishling Sheridan, 1yr - Maddie Shevlin, until 2021 - Kristy Stratton, 1yr
Movements: 🔄 - Sarah Dargan to Richmond - Sarah D’Arcy to Richmond - Katie Lynch to Western Bulldogs
Delistings: ✴️ - Kaila Bentvelzen (step away) - Georgia Gourlay (delisted) - Emma Grant (retired) - Eliza Hynes (retired) - Machaelia Roberts (retirement)

Fremantle Dockers:

Signed: ✅ - Ebony Antonio, until 2022 - Kara Antonio, until 2022 - Kiara Bowers, until 2022 - Tayla Brealand, until 2021 - Steph Cain, until 2021 - Janelle Cuthbertson, 1yr - Sabreena Duffy, until 2021 - Evie Gooch, 1yr - Katie Jayne Grieve, 1yr - Gemma Houghton, until 2021 - Leah Mascall, 1yr - Ann McMahon, 1yr - Hayley Miller, 2yrs - Emma O’Driscoll, 1yr - Gabby O’Sullivan, until 2022 - Laura Pugh, 1yr - Roxy Roux, 2yrs - Matilda Sergeant, until 2021 - Philipa Seth, until 2021 - Ashley Sharp, until 2021 - Ange Stannett, until 2021 - Jasmine Stewart, 1yr - Mim Strom, 2yrs - Tarnee Tester, 1yr, free agent signing - Aine Tighe, 1yr - Jess Trend, 1yr - Bianca Webb, 1yr - Alex Williams, 1yr
Movements: 🔄 - Tayla Bresland to West Coast Eagles
Delisted: ✴️ - Mia-Rae Clifford (delisted) - Sarah Garstone (delisted) - Lindal Rhode (delisted - Kate Flood (personal reasons)

Geelong Cats:

Signed: ✅ - Maddie Boyd, 1yr - Millie Brown, 2yrs - Rene Caris, 1yr - Georgia Clarke, 1yr - Rocky Cranston, 1yr - Julia Crockett-Gills, 2yrs - Kate Darby, 1yr - Renee Garing, 1yr - Nicole Garner, 1yr - Rebecca Goring, 1yr - Danielle Higgins, 2yrs - Jordan Ivey, 1yr - Maddy Keryk, 2yrs - Madisen Maguire, 1yr - Amy McDonald, 2yrs - Meghan McDonald, 2yrs - Maddy McMahon, 1yr - Phoebe McWilliams, 1yr - Nina Morrison, 2yrs - Aasta O’Connor, 1yr - Olivia Purcell, 1yr - Georgie Rankin, 1yr - Mia Skinner, 1yr - Denby Taylor, 1yr - Sophie Van De Heuvel, 2yrs - Rebecca Webster, 2yrs
Movements: 🔄
Delisted: ✴️ - Cassie Blakeway (delisted) - Melissa Hickey (retired) - Anna Teague (retired) - Gemma Wright (delisted)

Gold Coast Suns:

Signed: ✅ - Lauren Ahrens, 1yr? - Alison Drennan, 1yr - Hannah Dunn, 1yr? - Tiarna Ernst, 1yr? - Cheyenne Hammond, 1yr? - Ellie Hampson, 1yr? - Dee Heslop, 1yr? - Kalinda Howarth, 1yr? - Paige Parker, until 2021 - Brittany Perry, 1yr? - Jade Pregelj, 1yr? - Molly Ritson, 1yr? - Jamie Stanton, 1yr? - Kate Surman, 1yr? - Serene Watson, 1yr? - Jacqui Yorston, 1yr?
Movements: 🔄 - Charlotte Hammans to Carlton - Taylor Smith to Brisbane
Delisted: ✴️ - Georgia Breward, (delisted) - Lexi Hamilton, (delisted) - Maddy Roberts, (delisted) - Tayla Thorn, (delisted) - Kitara Whap-Farrar, (delisted)

GWS Giants:

Signed: ✅ - Jessica Allan, 1yr - Nicola Barr, 1yr - Rebecca Beeson, 2yr - Elle Bennetts, 1yr - Yvonne Bonner, 1yr - Jess Dal Pos, 1yr - Taylah Davies, 1yr - Alicia Eva, 2yr - Georgia Garnett, 1yr - Emily Goodsir, 1yr - Sarah Halvorsen, 1yr - Tanya Hetherington, 1yr - Jodie Hicks, 1yr - Annalyse Lister, 1yr - Tait Mackrill, 2yr - Erin McKinnon, 1yr - Alyce Parker, 2yr - Rebecca Privitelli, 2yr - Pepa Randall, 2yr - Aimee Schmidt, 1yr - Katherine Smith, 2yrs - Cora Staunton, 1yr - Lisa Steane, 1yr - Louise Stephenson, 2yr - Britt Tully, 1yr - Haneen Zreika, 1yr
Movements: 🔄 - Lisa Whiteley to Adelaide Crows
Delisted: ✴️ - Ellie Brush (retired to focus on Matildas/Olympic opportunity - Ingrid Nielsen (retired) - Maggie Gorham (retired)

Melbourne Demons:

Signed: ✅ - Libby Birch, 2yrs - Gabby Colvin, 1yr - Tegan Cunningham, until 2021 - Meg Downie, until 2021 - Chantel Emonson, 2yrs - Maddi Gay, 2yrs - Sinead Goldrick, 1yr - Tyla Hanks, 2yrs - Shelley Heath, 2yrs - Kate Hore, 2yrs - Sarah Lampard, until 2021 - Lauren Magee, 1yr - Niamh McEvoy, 1yr - Lily Mithen, 2yrs - Jackie Parry, 1yr - Karen Paxman, 1yr - Daisy Pearce, 1yr - Lauren Pearce, until 2021 - Krstel Petrevski, 1yr - Shelley Scott, 1yr - Casey Sherriff, 2yrs - Shae Sloane, 1yr - Breanna Tarrant, 1yr - Eden Zanker, 2yrs
Movements: 🔄 - Harriet Cordner to Richmond - Maddy Guerin to Carlton - Bianca Jakobsson to St Kilda - Aliesha Newman to Collingwood - Elise O’Dea fo Carlton - Katherine Smith to GWS
Delisted: ✴️ - Ainslie Kemp (delisted)

North Melbourne Kangaroos:

Signed: ✅ - Grace Campbell, 1yr? - Mia King, 2yrs
Movements: 🔄 - Abbey Green to (Collingwood) - Jess Trend to Fremantle Dockers
Delistings: ✴️ - Chloe Haines (delisted) - Libby Haines (delisted) - Emma Humphries (delisted) - Taylor Mesiti (step away) - Mairead Seoighe (delisted)

Richmond Tigers:

Signed: ✅ - Christina Bernardi, until 2021 - Maddy Brancatisano, 1yr - Katie Brennan, until 2021 - Hannah Buchell, 1yr - Akec Makur Chuot, 1yr - Monique Conti, until 2021 - Harriet Cordner, 1yr - Sarah D’Arcy, 1yr - Sarah Dargan, 1yr - Kate Dempsey, 1yr - Alice Edmonds, 1yr - Sabrina Frederick, until 2021 - Emily Harley, 1yr - Sarah Hosking, 2yrs - Kodi Jacques, 1yr - Laura McClelland, 1yr - Sarah Molan, 1yr - Phoebe Monahan, 1yr - Rebecca Miller, 1yr - Ilish Ross, 1yr - Sarah Sansonetti, 1yr - Cleo Saxon-Jones, 1yr - Gabby Seymour, 1yr - Tayla Stahl, 1yr - Courtney Wakefield, 1yr - Holly Whitford, 1yr - Alana Woodward, 1yr
Movements: 🔄 - Grace Campbell to North Melbourne
Delistings: ✴️ - Laura Bailey (retired) - Nakaela Butler (delisted - Ciara Fitzgerald (delisted - Emma Horne (delisted) - Lauren Tesoriero (retired) - Ella Wood (retired)

St Kilda Saints:

Signed: ✅ - Nadia von Bertouch, until 2022 - Ali Brown, until 2022 - Rosie Dillon, 2yrs - Jayde Van Dyk, 1yr? - Nat Exon, 1yr - Clara Fitzpatrick, until 2022 - Caitlin Greiser, until 2022 - Darcy Guttridge, 1yr - Bianca Jakobsson, 1yr? - Selena Karlson, until 2021 - Poppy Kelly, until 2022 - Tilly Lucas-Rodd, 2yrs - Tamara Luke, until 2022 - Kate McCarthy, until 2022 - Molly McDonald, 2yrs - Georgia Patrikios, until 2022 - Cat Phillips, 1yr - Hannah Priest, 2yrs - Isabella Shannon, 2yrs - Kate Shierlaw, until 2022 - Olivia Vesely, 2yrs - Rhiannon Watt, 2yrs - Tarni White, 2yrs - Claudia Whitfort, 1yr - Nicola Xenos, 2yrs
Movements: 🔄 - Jess Sedunary to Adelaide Crows - Alison Drennan to GC Suns
Delistings: ✴️ - Sammie Johnson (delisted) - Mel Kuys (delisted) - Emma Mackie (retired) - Courteney Munn (retire) - Kelly O’Neill (delisted)

West Coast Eagles:

Signed: ✅ - Ashlee Atkins, until 2021 - Mikayla Bowen, 2yrs? - Tayla Bresland, 1yr - Hayley Bullas, 2yrs? - Imahra Cameron, 2yrs? - Mhicca Carter, Rookie - Melissa Caulfield, until 2021 - Maddy Collier, until 2021 - Beatrice Devlyn, 1yr - McKenzie Dowrick, until 2021 - Kellie Gibson, until 2021 - Brianna Green, until 2021 - Courtney Guard, until 2021 - Ashton Hill, 1yr - Dana Hooker, until 2023 - Alicia Janz, until 2021 - Parris Laurie, until 2022 - Grace Kelly, 2yrs - Niamh Kelly, 2yrs - Aisling McCarthy, 1yr - Sophie McDonald, 1yr - Kate Orme, 1yr - Chantella Perera, 1yr - Belinda Smith, until 2022 - Emma Swanson, until 2021
Movements: 🔄
Delisted: ✴️ - Talia Radan (retired) - Kate Bartlett (delisted) - Emily Bonser (retired) - Cassie Davidson (delisted) - Emily McGuire (delisted) - Daniela Pisconeri (delisted) - Tarnee Tester (delisted)

Western Bulldogs:

The Doggies didn’t specify contract lengths per player, so take ‘1yr’ with a grain of salt
Signed: ✅ - Deanna Berry, 1yr - Ellie Blackburn, 1yr - Eleanor Brown, 1yr - Naomi Ferres, 1yr - Ellyse Gamble, 1yr - Elisabeth Georgeostathis, 1yr - Angelica Gogos, 1yr - Isabella Grant, 1yr - Ashleigh Guest, 1yr - Britney Gutknecht, 1yr - Katy Herron, 1yr - Bailey Hunt, 1yr - Isabel Huntington, 1yr - Gemma Lagioia, 1yr - Kirsty Lamb, 1yr - Brooke Lochland, 1yr - Katie Lynch, 1yr - Dani Marshall, 1yr - Kirsten McLeod, 1yr - Celine Moody, 1yr - Nell Morris-Dalton, 1yr - Gabby Newton, 1yr - Kim Rennie, 1yr - Hannah Scott, 1yr - Lauren Spark, 1yr - Bonnie Toogood, 1yr - Amelia Van Oosterwijck, 1yr
Movements: 🔄 - Aisling McCarthy to West Coast Eagles - Hannah Munyard to Adelaide Crows
Delisted: ✴️ - Nicole Callinan (retired)
submitted by tiny_doughnut to AFL [link] [comments]


2020.06.18 15:10 IPlayTrackFoundation Foy Draper, ran the third leg on the 1936 relay team that set the World Record and won the gold... He was killed in action during World War II over Tunisia in the Battle of Kassarine Pass.

Foy Draper, he was an Olympian, great NCAA athlete, and a Veteran. He gave Jesse Owens a close call when he clocked in a time of 10.3 for 100m at the 1935 NCAA Championships. Draper, who ran the third leg on the 1936 relay team, was killed in action during World War II. He was reported missing in action while flying over Tunisia in the Battle of Kassarine Pass on Jan 4th, 1943.
At the 1936 Olympic Games in Berlin, Draper with the team of Jesse Owens, Ralph Metcalfe, and Frank Wykoff won the gold in a world record time of 39.8.
Draper reportedly held the world record for the 100-yard dash, at the time that would have been a hand timed 9.4.
He had enlisted in the Army Air Forces. Entered via Regular Military. He eventually had the rank of Captain with 47th Bomber Group, Light, 97th Bomber Squadron.
Later on during World War II, Draper served as a pilot on a twin-engine attack bomber A-20B 'Havoc' in Thelepte, Tunisia. On January 4, 1943, Draper took off to fly to Fonduck, Tunisia to take part of the battle of Kassarine Pass. Draper and his two crewmen never returned and his death date often given as February 1, 1943. He is still considered MIA.
https://www.facebook.com/1228761723824335/posts/3515063531860798/?d=n
submitted by IPlayTrackFoundation to AdvancedRunning [link] [comments]


2019.08.03 22:18 LanceGardner Retrospective Review of S1E1 and S1E2.

WARNING: POST CONTAINS SPOILERS FOR ALL SEVEN SEASONS OF BUFFY.

As I’m interested in getting into online journalism, I’ve decided to practise writing and increase my portfolio by posting a somewhat lengthy retrospective review for the first double episode of Buffy (what with the revival potentially coming up). I’m interested in any comments on the review, and also just general discussion about the ep. If people appreciate the post, I would gladly write some more.
Here goes:

Retrospective Review of Welcome to the Hellmouth and The Harvest

It’s quite appropriate that the first scene in Buffy is dedicated not to introducing the titular protagonist, but rather Sunnydale High School. The school forms a fundamental part of the show’s initial identity - it would later redefine itself - and it’s Horror 101 as we watch Catholic school-girl edition Darla (Julie Benz) and nameless male student (Carmine Giovinazzo) break into the science lab while a slightly overly-enthusiastic camera swoops through the darkened rooms and pans around them. They discuss going up to the roof of the gym as sinister music plays in the background, and we wait to find out whether the male student is a threat, or if some unseen monster will hunt the both of them… until showrunner Joss Whedon plays his first trump card. The victim and aggressor roles are abruptly switched, as Darla reverts to her vampire form and kills the boy who a moment earlier had been exuding some decidedly predatory-male vibes.
Buffy is by no means the first horror work to play this kind of reversal, but it resonates for a number of reasons. Joss Whedon has talked at length about the embryonic idea which would eventually become the show: what would happen if, in the countless horror B-movies in which a fragile, scantily-clad blonde cheerleader is pursued and killed by a monster, that dynamic was flipped on its head? Buffy – the character Buffy – was born. It’s a brilliant concept, and in many ways Darla is the dark bloom grown from the same seed of that initial idea: a delicate, husky-voiced fair-haired girl is led into a darkened corridor by a sexually aggressive young man, but we shouldn’t make any assumptions about where the situation might end up. A key point of the show’s mythology is also established during the exchange, with unsettling implications: evil looks normal until it’s too late. This concept would later evolve over the course of the show in a variety of ways: evil is just ordinary people (the Trio); evil is ourselves (Angelus, Dark Willow); evil is our insecurities and grief and depression (the First).
It’s a strong statement thematically, which is necessary, because by modern standards the production values of that first scene – and the rest of the episode – are not particularly high. Signs of the low budget are evident throughout, in the absurd prosthetics, poor CGI and obvious stunt doubles. The direction itself is not exactly poor, but it’s considerably less polished than one would expect from today’s shows, using transitions such as the camera panning from a sewer to Giles’ library in a single take with only a black wall separating the two sets, not to mention the freeze frame with the words To Be Continued appearing above an open-mouthed vampire leaning in to bite Buffy’s neck halfway through the two-part episode. This type of showy – and pointless – technique is more appropriate to a first-year film student than a professional, and it’s clear that Whedon is still finding his feet here.
Nonetheless, events nip along at a brisk pace as the major players in the first season – Joyce (Kristine Sutherland), Xander (Nicholas Brendon), Willow (Alyson Hannigan), Cordelia (Charisma Carpenter), Giles (Anthony Stewart Head), Angel (David Boreanaz) and the Master (Mark Metcalf) – are introduced one by one, with scenes designed to highlight one or two key character beats for each. Joyce is worried about Buffy settling in and is overly-stressed, Xander is goofy and has a crush on Buffy, Willow is a nerd and has a crush on Xander, Cordelia is Cordelia, Giles is English (and somehow decidedly creepier and more awkward than in later episodes), Angel is brooding and mysterious, and the Master wants to bring about the end of mankind as we know it. While some of the material in these early scenes was later ditched (whatever happened to Xander’s skateboard?), most of the characters are given a competent introduction which is more or less consistent with their characterisation throughout the show as a whole.
More importantly, there is considerable raw talent on display in the cast which elevates the material. It is rare for a television show to launch the career of so many bankable stars (David Boreanaz and Alyson Hannigan both built successful careers following the show, while Anthony Stewart Head and Sarah Michelle Gellar both greatly improved their marketability), and the chemistry between the leads is genuine and shines through – especially once the Scooby gang is assembled. The script is somewhat – and understandably – dated now (it’s hard to imagine a time when a teenager could really believe that the Del key on a keyboard refers to Deliver rather than Delete), but nonetheless it is full of enjoyable moments, such as the following delightful exchange between Buffy and the vampire Luke (Brian Thompson):
LUKE You forget. Metal can't hurt me. BUFFY There's something you forgot about, too. Luke hesitates, doubt clouding his face. BUFFY (dramatically) Sunrise. She takes the cymbal stand and HURLS it right through the plate glass window at the back of the stage, SHATTERING the entire thing. He turns and SCREAMS, raises his hands… and stops. Puzzled. Buffy DRIVES the stake in through his back. He arches forward, in real agony this time. BUFFY It's in about nine hours, moron. 
There are moments which reward the returning viewer, too, such as the brief appearance of Harmony (Mercedes McNab) in Cordelia’s friendship group (she’s not named here, but against all odds she would go on to be the most enduring secondary character on the show, the only cast member besides Boreanaz to appear in both the first episode of Buffy and the final episode of Angel).
With that in mind, it’s easy to grin and bear the not-quite-so-good aspects of the episode. The characters all take the threat seriously, but it’s hard to join them when the villain (the Master) is so amusingly hammy. Buffy shouldn’t be pure horror, but later villains are able to instil some real menace, whereas the Master’s lair and mannerisms seem rather better suited to a show such as Power Rangers. Luke is slightly more threatening, but still suffers from poor make-up and a slightly premature demise. It’s hard not to roll one’s eyes at the pair of them ending the world, but then Buffy has always been rather too eager to bandy about the threat of an impending apocalypse. Perhaps it may be excused this one, on the basis of it being the first episode.
Another frustration is the death of Jesse (Eric Balfour). He is presented here as Willow and Xander’s close friend (the original intention – cut for budgetary reasons – was for Balfour to appear in the episode’s title sequence to increase the shock of his dying, a trick which Whedon would eventually employ with Tara [Amber Benson] in the episode Seeing Red). This makes the fact that he is never mentioned again feel somewhat cheap – it really wouldn’t have been difficult to show a little of the fallout of his death later on, at least in a throwaway line or two. Joss Whedon was apparently aware of this, planning for Balfour to return 128 episodes later in the Season 7 episode Conversations with Dead People and to call Xander out on it. Unfortunately, the scene never transpired, with Balfour unable to commit for scheduling reasons.
There are also continuity issues throughout with later episodes (Darla doesn’t seem to know what a slayer is, for example, and a great deal of the vampire lore is later rewritten) but again, these are all part and parcel of a show’s first few episodes, and may be forgiven. Similarly pardonable is the fact that the sound quality is not the best (with the exception of the iconic theme tune, the music sounds like the type of horror tracks bundled in with any video editing program nowadays). The version of the intro theme we get in this episode is in many ways representative of the episode as a whole – it’s poor quality and accompanied by the kind of editing any kid with windows movie maker and a YouTube account might accomplish, but it’s still a damn good tune.
All things considered, Welcome to the Hellmouth and The Harvest do what they need to do, but very little more. The feeling that Joss Whedon hasn’t yet realised the potential of the world that he has created is omnipresent, but he and the cast members offer intriguing hints of what they’re capable of. In fact, one could argue that this stuttering start forms part of the show’s charm – to watch Buffy grow alongside its characters is a pleasure, and from that perspective the talented but raw initial offering is an apt place to begin. Unlike some other shows, Buffy would later not only live up to that early promise, but easily surpass whatever expectations might have been created by it.

Rating: 6 out of 10
submitted by LanceGardner to buffy [link] [comments]


2019.04.08 20:39 newsfeedmedia Olivia Culpo spotted with Aaron Varos during double-date with Cara Santana and Jesse Metcalfe

Olivia Culpo spotted with Aaron Varos during double-date with Cara Santana and Jesse Metcalfe submitted by newsfeedmedia to newsfeedmedia [link] [comments]


2019.03.06 01:56 tombstoneshadows28 Every horror film listed on IMDB for the calendar year 2019 (grouped by current state of completion as of time of this posting.) Part 1 of ?)

Currently In Pre-Production for 2019
  1. Help Wanted (2019/Dave Bundtzen)
  2. From Me to You (2019/Simret Cheema-Innis)
  3. Helping Hands (2019/Benji Sandergaard)
  4. Help Wanted (2019/Dave Bundtzen
  5. Uncle Avery (2019/Charles S. Frank)
  6. Guys at Parties Like It (2019/Colton David Coate and Micah Coate)
  7. Aim for the Eye (2019/Peter Gamble Robinson)
  8. Deadtime Travels - Dead Before Dusk (2019/George Meyers)
  9. It's All Fun and Games (2019/James B. Thomasson)
  10. Das Mädchen und der Bulle (2019/Dominik Heit)
  11. Apparitions (2019/Perri Cummings and Paul Anthony Nelson)
  12. Still (2019/Jeff Kapp)
  13. 360 Seconds of Nothing (2019/10m/Preston Hazard)
  14. Devil (2019/Nathan Frankowski)
  15. Untitled Dream Film (2019/Patricio Gonzalez)
  16. Clowns (2019/Nikki Tomb)
  17. What Remains of Us (2019/Scott W. Perry)
  18. A Christmas Past (2019/Cheyanne Marie Smith)
  19. Disturbed Remains (2019/Michael Jamal Mitchell)
  20. Addition By Subtraction: The Rise To Power (2019/Terrell Williams)
  21. Inaudible Screams (2019/Todd Bagley and W. Abbey Mercando)
  22. Upon Arrival (2019/Scott W. Perry)
  23. The Man (2019)
  24. Dog Skin (2019/Tiago Teixeira)
  25. A Deal with Death (2019/Chrissie Harper)
  26. Hand Painted Coffin (2019/Ian Spencer Holt)
  27. Before Nightfall (2019/15m/Daniel Bushen)
  28. Ghost Babes (2019/K.H. Orth)
  29. Grotesque (2019/Brandon Rhiness)
  30. Doomed (2019/Kevin Brame)
  31. The Matriarch (2019/Bianca Crespo)
  32. Await the Dawn (2019/Pablo Macho Maysonet IV)
  33. Blind Date (2019/Maurice Nix)
  34. Red Eleven: Starry Eyes (2019/Jesse Haaja)
  35. Hosts (2019/Adam Leader and Richard Oakes)
  36. Z: The Story Of What A Zombie Feels Once It's Reanimated (2019/Daniel Mart)
  37. New Tale: The Demon of Elm Street (2019/Chris R. Notarile)
  38. Candle in the Dark (2019/Jonny White)
  39. Caminos Separados (2019/Henri Escoto)
  40. Hazard (2019/Henri Escoto)
  41. Soulless (2019/Dominic Brunt)
  42. Add fel! (2019/Vilmos Heim)
  43. Violet (2019/Samuel Vainisi)
  44. Stringer (2019/Colten Dietz)
  45. Ramona (2019/Nicki Harris)
  46. Confessions of a Teenage Satanist (2019/Steve Custodio)
  47. Bourgeois Absolutie (2019/Jorrit Bouwmans and Jasper Koopmans)
  48. Devil Music (2019/Jim O'Rear and Scott Tepperman)
  49. Faces of the Dead (2019/Will Collazo, Jr.)
  50. The Haunting of Pottersfield (2019/Andre Dixon)
  51. It's Personal (2019/Claire Chubbuck)
  52. Paimon (2019/Jorden Pasols)
  53. Optic Nerve (2019/Peter Hartsock)
  54. The Dracula Cult (2019/91m/Stanley Joseph)
  55. Winter Blood (2019/ Pre-production/Jermaine Nix and Austin Bitikofer)
  56. Silver (2019/Guy Soulsby)
  57. Something Wrong (2019/110m/Azhar Hussain)
  58. To Devon with Love (2019)
  59. Baba Yaga (2019/Richard John Taylor)
  60. Hellbilly Hollow (2019/Kevin Wayne)
  61. Bad Deal (2019/Derek Dodder)
  62. Pure (2019/Derek Dodder)
  63. Dead Dicks (2019/Chris Bavota and Lee Paula Springer)
  64. Doorway (2019/Joe Hammerstone)
  65. Doll House (2019/Steven M. Smith)
  66. Return to Sender (2019/8 min/Haley Noelle Cummings)
  67. The Moon, The Bat, The Monster (2019/Robbie Dias)
  68. Help Me: Begins (2019/Marco Bottiglieri)
  69. Desert Shadows (2019/Tyler Bourns)
  70. The Regret (2019/Bruce Troxell)
  71. Murmur (2019/Natalie McCoy)
  72. Little Darling (2019/Samuel Gonzalez, Jr.)
  73. Repression (2019/3m)
  74. The Ungulate (2019/Davy Lantz, Jr.)
  75. Project Asylum (2019/Robert Gillings)
  76. Halloween: Unforgiving (2019/Ryan Gregory)
  77. The Devils (2019/Matthew Spradlin)
  78. The Compound (2019/Matt Steel)
  79. The Defiler (2019/Marvin Williams)
  80. Tonton Macoute (2019/Nigel Robinson)
  81. Trudi Bowman: The Blue Scarf Killer (2019/Stephen Pimblett)
  82. The Nasty Little Sex Perv Next Door (2019/30m/Michael Sean Erickson)
  83. The Shade (2019/Nick Canning)
  84. Halloween: Return of the Shape (2019/102m/Gabriel Abu-Zeid)
  85. Apóstata (2019/Hugo Cobo)
  86. In Search of Fear (2019/John K. Webster)
  87. The Reckoning (2019/Neil Marshall)
  88. The London Tombs (2019/John K. Webster)
  89. Trick (2019/Patrick Lussier)
  90. Cremated (2019/K.J. Karving)
  91. Slumber Party Slaughter Party 2 (2019/DeWayne Etheridge)
  92. Young Blood (2019/Blair Hoyle)
  93. Resurgent (2019/Keith Parmer)
  94. ZELL 2 (2019/Alexzander Rogers)
  95. Halloween Night (2019/Brittani Baloga)
  96. Single Family Home (2019/Bel Deliá and Tara C. Hall)
  97. Swine Ear (2019/Cullen Ritchie and Phoenix Wilson)
  98. Clown vs. Vampires (2019)
  99. Clown vs. Vampires (2019/Michael Worth)
  100. Michael Myers vs Freddy Kruger (2019/Lazaro Diaz)
  101. Freddy Kruger (2019/Lazaro Diaz)
  102. Michael Myers Comes Home 2 (2019/Lazaro Diaz)
  103. The Dark Sins of the Flesh (2019/Kevin Hernzorth)
  104. 13: Fanboy (2019/Deborah Voorhees)
  105. Relic (2019/Natalie Erika James)
  106. Deep Hatred (2019/Daniela Carvalho)
  107. Landgraves (2019/Jean-François Leblanc)
  108. Create Your Killer (2019/Sarah Giercksky)
  109. Merry Christmas, Mofos 3.0: Next GEN (2019/Cheyanne Marie Smith)
  110. Suffer (2019)
  111. Merry Christmas, Mofos 2.0: New Year's Eve (2019/Cheyanne Marie Smith)
  112. Horror by Midnight (2019/92m/Barry J. Gillis)
  113. Setan Munafik (2019/Yosua Rocky and Majed Salleh)
  114. Forbidden (2019/Edwin Legette)
  115. Seclusive Fright (2019/Benjamin Baker and Parker Knight)
  116. Turno Nocturno (2019/Post-production/J. Luis Rivera)
  117. Patina (2019/Alan Maxson)
  118. Shadowland (2019/Post-production/Simon Kay)
  119. Broken Down (2019/Alejo Vega)
  120. This Guest of Summer (2019/Graham McTavish)
  121. The Jonestown Haunting (2019/85m/Andrew Jones)
  122. From Darkness (2019/Ryan Woebbeking)
  123. Uncle Otto's Truck (2019/Dan Sellers)
  124. Kill Giggles (2019/Jaysen P. Buterin)
  125. A Girl Lost (2019/Priscilla Walton)
  126. The Session (2019/Rhiannon Moller-Trotter)
  127. My Personal Slave (2019)
  128. Bikini Ghost Girls (2019/Kev V. Orth)
  129. Three Black Roses (2019/Kev V. Orth)
  130. Road Head (2019/David Del Rio)
  131. The Woods (2019 Video/60m/Ryan J. Lewis and Brooklyn Valera)
  132. Night of the Living Dead Part II (2019)
  133. Uroboro (2019/110m/Roberto Valdés)
  134. The Embraced (2019/Johnny Holiday
  135. L'intruso (2019/Francesco Roder)
  136. Inhumane (2019/Caleb Vetter)
  137. Nightmare (2019/Diablo Vilhelm)
  138. Ruby (2019/Roger Sampson)
  139. Camp Site (2019/Jerry Collins and Hershel Layne)
  140. Tourette's and Zombies, the Musical (2019/Zak Ferguson)
  141. Repeat. (2019/Adam McCabe)
  142. Must Escape from the Slaughtercity (2019/Hank Biro)
  143. A Wicked Breed (2019/Derek Talib and Rebekah Hart Franklin)
  144. Tweed (2019/Alexander Wraith)
  145. Harp Brothers (2019/David Risotto)
  146. The Evil That Came to Denham (2019/Sharlene Humm)
  147. The Gladds (2019/Dominic Wieneke)
  148. Cattre: The Death Lullaby (2019/Edo Tagliavini)
  149. Ravage (2019)
  150. Death Care (2019/Daniel Murphy)
  151. The Rage 2 (2019/Joshua Cleave)
  152. Carver Cove (2019/Preston Walden)
  153. The End Was Then (2019/Rocky Karlage)
  154. Blue Eyes (2019/Chris Alexander)
  155. Kawaii (2019/10m/Gabriella Kapsaski)
  156. The Final Rose (2019/ Pre-production/Michael Davis)
  157. Ankou (2019/Dave Stishan)
  158. BLACK I IS LEE (2019/Mackey Lavond)
  159. Survival of the Apocalypse (2019/Anthony Caban)
  160. The Surreal Project (2019/József Gallai)
  161. The Barricade (2019/Curtis Carnahan)
  162. Bickle (2019/P.M. Lipscomb)
  163. Lycanthrope (2019/Roger Sampson)
  164. A Spriggan (2019/Keir Burrows)
  165. Darkest Light (2019/Francisco Matias)
  166. Winterwood (2019)
  167. Lux is Mortem (2019/Cain McMillan)
  168. Department 666 (2019/Adam York)
  169. The Evil Marriage (2019/Abrar Rana)
  170. The Russian Razor Massacre 3: The Last Razor (2019/Evgeniy Mishukhin)
  171. Wicked Ones (2019/Tory Jones)
  172. Teacher Shortage (2019/Troy Escamilla)
  173. Boogeyman 2: Curse of the Monster (2019/Evgeniy Mishukhin)
  174. They Came from the Woods (2019/Devin Hansen)
  175. The Necroplasmic Massacre (2019/Sébastien Godin)
  176. Folklore (2019/Michael A. Isaacs)
  177. Desper Hollows (2019/Michael Lindsey)
  178. Omnicron (2019/Caillou Pettis)
  179. Ex Oblivione (2019/Aaron Franke)
  180. Watchmen: Los Vigilantes (2019/189m/Jose Luis Garcia Baylon)
  181. Down There (2019/Adam Hartwick)
  182. Videoteka (2019/Luka Bursac)
  183. Trap House (2019/Steven Metcalf)
  184. The Existence (2019/Buppha Witt)
  185. Snarl (2019/L.J. 'Stark' Greenwood)
  186. Drain Away: Is Pure Longing a Sin? (2019/108m)
  187. Eternal Night of the Dead (2019/Mathew Kister)
  188. The Thing That Keeps You (2019/Preston Walden)
  189. Untitled Horror Project by IndustryWorks Studios (2019/Chris Alexander)
  190. Unnatural Selection (2019/Garth Maxwell)
  191. Batman: Year One (2019/Jose Luis Garcia Baylon)
  192. Call Workshop (2019/Jason Ledford)
  193. Hero and the Girl (2019/Rubén Arnaiz)
  194. Fright Force 2021 (2019 Video/65m/Ernest Serrano)
  195. S.O.H.N.: The Rise of Achak (2019/Chad Ferrin and Justin Price)
  196. Hellion a Horror Anthology (2019/120m/Matthew Dixon)
  197. Something Crashed in the Woods (2019/Jeff Profitt)
  198. The Twin (2019/Max Derin)
  199. Whispers in the Basement of Darkness (2019/Jeff Profitt)
  200. The House Across the Lake (2019 Pre-production/Jennifer Dawn and Russell Hoffman)
  201. Forest of Paranormal (2019/Jeff Profitt)
  202. Cool Air (2019/Scott Young)
  203. The Music of Erich Zann (2019/Scott Young)
  204. In His Name (2019)
  205. Bigfoot Bachelor Party Massacre (2019/Ryan Lightbourn)
  206. The Treasure Box (2019/Servet Dean Sari)
  207. The Picture Man (2019/Servet Dean Sari)
  208. Hunting Season (2019/Megan Freels Johnston)
  209. Slaughter Horse (2019/Toby Johansen)
  210. Safe Space (2019)
  211. Scout (2019)
  212. Junction Murders (2019/90m)
  213. Walk with Me (2019/8m/Ellier Dov)
  214. Accidental Death (2019/85m/Seric Drac)
  215. Eat Lead (2019/Bryan Bockbrader)
Currently-Filming for 2019
  1. High Priest (2019/Roderick E. Stevens)
  2. Terror at Bell's End (2019/Chrissie Harper)
  3. Leaper (2019/Ryan John)
  4. Scar (2019/Evgeniy Vaganov)
  5. Rise of the Mummy (2019 /Kevin McDonagh)
  6. Night (2019/Nicholas Michael Jacobs)
  7. Bekçi (2019/35 min/Turgut Eryilmaz)
  8. Haunted Cries (2019/Nik Rasmussen)
  9. The Haunting at Beverly Mansion (2019/70m/Lee Jones)
  10. The Last Christmas (2019/10 min /Ryan Port)
  11. Crimson Clinic (2019/Jeffrey Arsenault)
  12. Infamous Six (2019/Anthony Hickox)
  13. The Haunting of Amelia (2019/K.H. Orth)
  14. Voorhees (2019 Video/Cody Faulk)
  15. Desert Wolf (2019/Beau Yotty)
  16. Where Blood Lies (2019/12m/Byron Q.)
  17. The Man With The Balloon (2019/Derrick Perez)
  18. Heartless (2019/Harris Goodkind)
  19. Pandamonium (2019/Mj Dixon)
  20. Tales of the Creeping Death (2019/John Williams)
  21. The DVD (2019/Cody Clarke)
  22. Jac Kessler's Popsy (2019/Jac Kessler)
  23. Camp Terror (2019/90m/Sam Winters)
  24. Nachtschicht (2019/Claudio Sipka)
  25. Empty Roads (2019/Benji Tucker)
  26. Dhampirica (2019/Felipé Ruiz)
  27. Host (2019/Kyle Stoutz)
  28. Gone (2019/Felix Martiz)
  29. D.E.M.O.N.I.C. Stories (2019/Kii Hornick)
  30. A Night at the School (2019/Vinson Russell, Jr.)
  31. Drain Away - Would you die for me? (2019/24m/Reila Aphrodite)
  32. Iruttu (2019/Durai)
  33. GetAWAY (2019/Blayne Weaver)
  34. Deathcember (2019/Steve De Roover, Ruggero Deodato, Florian Frerichs, Rémi Fréchette, Trent Haaga, Ama Lea, Sang-woo Lee, John Lynch, Andreas Marschall, Pollyanna McIntosh, Lucky McKee, Chelsea Stardust Peters, Bob Pipe, Julian Richards, Jason A. Rostovsky, Vivienne Vaughn, Sam Wineman, Lazar Bodroza, B.J. Colangelo, Sonia Escolano, Isaac Ezban, Sadrac González-Perellón, Juergen Kling, Annika Marx, Dominic Saxl, R. Zachary Shildwachter, Milan Todorovic and Michael Varrati)
  35. Empty House (2019/Rabbi Khan)
  36. Devil in the Woods (2019/Terence Elliott)
  37. Released (2019/Maverick A Bolen)
  38. The Party (2019/Julianna Robinson)
  39. Outcast (2019/John Bennett)
  40. Dwellers (2019/Drew Fortier)
  41. Johnny Z (2019/Jonathan Straiton
  42. Voices (2019/15m/Jetto Dorsainville and Ron Weisberg)
  43. The Landlord (2019/Brett Droege)
  44. Halloween Creep Tales: Part 2 (2019/Bayden Ray Redshaw, Andrea Ricca and John H. Shelton)
  45. Cinderella (2019/Vinoo Venketesh)
  46. Night of the Wicked (2019/Shane Grant)
  47. Tokyo Ghoul 2 (2019/Kentarô Hagiwara)
  48. Blood-Red Ox (2019/Rodrigo Bellott)
  49. Charles (2019/Luis Serrano)
  50. Slayer (2019/Christopher Wall)
  51. Paintball Massacre (2019/Darren Berry)
  52. Fried Barry (2019/Ryan Kruger)
  53. The House on Plant (2019/Itchy)
  54. Dark 72 (2019/65m/Nicholas Grant)
  55. The Purge: Survival (2019/Sara Jimenez)
  56. The Unhaunted (2019/K.J. Karving)
  57. Lucifer's Satanic Daughter (2019/Chandler Thistle)
  58. Teen Tragedy (2019/Mitchell McKechnie)
  59. Nomad (2019/120 min/Sara Elizabeth Joyce)
  60. Dead Presidents (2019/Scott A. Best)
  61. Kreepie's Kurse (2019/Cameron Daboin)
  62. A Cry in the Night-The Legend of La Llorona (2019/David Jones and Joseph Cournoyer)
  63. Hell Girl (2019/Kôji Shiraishi)
  64. Harvest of Horrors (2019/Brad Twigg)
  65. Arbitrium (2019/Jonny Woollett)
  66. Philia (2019/Sam Mason-Bell, Maude Michaud, Chris Milewski, Tony Newton, Mike Peter Reed and Tyler Sage)
  67. The Diminished (2019/Mig Windows)
  68. All Who Follow (2019/Derek Hummel)
  69. Blacktop Massacre (2019/Christopher R. Sloan)
  70. Lisaa (2019/Raju Viswanath)
  71. Z Dead End (2019/Robert Resto)
  72. Indestructible: Reckoning (2019/Matt Spease)
  73. The Lost Reel (2019/Simon Cluett)
  74. Spring Fever (2019/Izzy Sutton and Chris McElyea)
  75. The Eidolon Inquest (2019/Mikeal Burgin)
  76. Attack of the Killer Chickens the Movie (2019/Genoveva Rossi)
  77. Boo (2019/Rakefet Abergel)
  78. The Trap (2019/Charlie Alejandro)
  79. Attack of the Unknown (2019/Brandon Slagle)
  80. Vengeance (2019/Jeremy W. Brown and Dustin Montierth)
  81. Something in the Shadows (2019/Cameron Grimm)
  82. Jade's Asylum (2019/Alexandre Carrière)
  83. The Good Things Devils Do (2019/Jess Norvisgaard)
  84. 12 Midnight (2019/Nicholas Molinari)
  85. Teenage Zombies (2019/Orlando Eastwood)
  86. The Snaker (2019 Filming/Tim Goodfellow)
  87. The Dark Web Tapes (2019/Jason Harlow and Jake Zelch)
  88. Goth Zombie (2019)
  89. Petrified (2019/Jacob Detheridge and Jared Marino)
  90. Essence (2019/Jeff Kacmarynski)
  91. The Shed (2019/Frank Sabatella)
  92. Home Videos 2 (2019/Gavin Damerell, Dustin Ferguson, Jason Figgis, Steven Longhurst, Sam Mason-Bell, Tony Newton, Mark Oakley, Mike Peter Reed and Gary Whitson)
  93. The Tokoloshe (2019/Richard Green)
  94. Secret of Selfie (2019/120m)
  95. Water Dawg (2019/Christopher Baiza)
  96. Fantastic Women (2019/João Pedro Fleck, Felipe M. Guerra and Nicolas Tonsho)
  97. Blood Tales (2019/96m/Jason Figgis, Jarrett Furst, József Gallai, Tony Newton, Edward Payson, Jocelyn Reynoso, Kai Undrell and Jonathan Zaurin)
  98. Parallel (2019)
  99. Dark Trepidation 2 (2019/Jason Bigart)
  100. Return of the Lost Movie: The Making of Mutant Swinger from Mars (2019 Video/60m/Michael Kallio)
  101. Willowvale Harbor (2019/Timothy Davis)
  102. The Exchange (2019/Henry Nader)
  103. Red Oedipal (2019/Shane Ryan)
  104. John in the Woods (2019)
  105. Baby Monitor (2019/Ryan Barton-Grimley)
  106. Full Circle: A Documentary (2019/Michael Kallio)
  107. Last Village on the Right (2019/James Crow)
  108. The Resellers Movie (2019/Jerome Cloutier)
  109. Surrealistic Nightmares: An In-depth Look at Walloon Horror Cinema (2019/101m/Steve De Roover and Jérôme Vandewattyne)
  110. Saving Grace (2019/90m/Gareth Carr)
  111. Blue Caveman (2019/Mike Delaney)
  112. UnDeadDeat Dad (2019/90m/Paul Overacker)
  113. Rotten Cotton (2019/Kasper Lewis)
  114. One Winter Night (2019/Ryan Callaway)
  115. Kecksburg (2019/Cody Knotts)
  116. Scenes of a Ghostly Nature (2019/C.R. Krishnan)
  117. Jack the St. Ripper (2019/George Nevada)
  118. The Harvest (2019/Daniel Brown and Joshua Brown)
Currently In Post-Production for 2019
  1. La Hermosa (2019/Lorian Gish and Justin Knoepfel)
  2. Bos/Taurus (2019/8m/Javier Cobo)
  3. I'll See You Next Week (2019/10m/Rodrigo Badoino)
  4. Stare (2019/Shawn Adams)
  5. Red Moon Lake (2019/Tim Vigil)
  6. The Last Leaf (2019/12m/Sia Aleskovskaya)
  7. A Creature Is Stirring (2019/Jeremy Ashley Pair)
  8. Toilet Trolls (2019/Hannah Kornberg)
  9. The Box (2019/Corey Slater)
  10. Blood Spirit (2019/Anthony Allin)
  11. The Children of the Night (Teaser) (2019/Frank Ponce)
  12. Enigma (2019/Aaron Paul Mendoza)
  13. Heavy Handed (2019/11m/Maitee Leonie)
  14. Satan’s Barn (2019/Thea Hvistendahl)
  15. Creepy John (2019/Shawn Robinson)
  16. Miranda Veil (2019/Levin Garbisch)
  17. The First Seal (2019/Ben Mathus)
  18. Me and the Devil (2019/88m/Dario Almerighi)
  19. Amme (2019/Fýr Romu)
  20. Maddong P.I. (2019/10 min/Nic Bonesteel)
  21. Lilith (2019/Mikel Thomas)
  22. A Night at the Table (2019/9m/Tamara S. Hall)
  23. Maya (2019/Karin Hallén)
  24. Wither (2019/3m/Ethan Evans)
  25. The Assent (2019/Pearry Reginald Teo)
  26. Bad House (2019/Charlie Steeds)
  27. Friend Zone (2019/8m/Isiah Miller)
  28. Caitlín (2019/Emer Conroy)
  29. Here in the Dark (2019/Gabriel Saint)
  30. The Nest (2019/Scott A. Martin)
  31. Majnun (2019/28m/Omer Naot)
  32. La venganza de Jairo (2019/Simon Hernandez)
  33. Tool Shed (2019 Video/4m/Rob Filios and James Filios)
  34. The Housewife (2019/Chloe Carroll)
  35. The Picture in the House (2019/42m/David Lapuch)
  36. Sacrificial Lamb (2019/Hayden McComas)
  37. Phlo (2019/J. Wilson Fielder)
  38. The Boy in the Picture (2019/60m/Ashley Dahl)
  39. Rotting Beauty (2019/Nyri Yaghoobian)
  40. Scuttle (2019/Harry Crossman)
  41. Charlotte The Return (2019/76m/Nathan Crooker, Kayden Phoenix and Ruben Rodriguez)
  42. Marika The Aatrupt (2019/Mohammad Zahid Ahmed)
  43. Eye Without a Face (2019/Ramin Niami)
  44. Anna 2 (2019/Michael Crum)
  45. The Dream II (2019/Tamás Körmendi)
  46. Cult of Nightmares (2019/David Paul Scott)
  47. Fifty Six (2019/James Mudge)
  48. Kronin (2019/Antony Smith)
  49. Flesher (2019/John Johnson)
  50. Knifecorp (2019/Zach Zorba Grashin)
  51. No Good Deed (2019/8m/Ethan Hanson)
  52. Deep Web (2019/Jessy Dupont)
  53. Nightmare (2019/Jason Smith)
  54. Devil's Revenge (2019/Jared Cohn)
  55. Mania (2019/Edson da Conceicao)
  56. Most Steps Ever (2019/4m/Nesib Shamah and James Allen Smith)
  57. Corvid's Head (2019/Sam Bhattacharjee)
  58. Playhouse (2019/90m/Fionn Watts and Toby Watts)
  59. Inflatio (2019/9 minPost-production/Bryon Evans)
  60. Dolls (2019/Cuyle Carvin)
  61. The God Man (2019/Jon Jacob Turner)
  62. Kara (2019/Catherine Kerr-Phillips)
  63. Daddy's Coming Home (2019/Brandon Rhiness)
  64. Verotika (2019/Glenn Danzig)
  65. Night Out (2019/Drew Maxwell Weiss)
  66. Empty Nest (2019/Joe Craib)
  67. Fatal Declare (2019/15m/Liam Pinheiro-Rogers)
  68. Hands Up (2019/Jeffrey Battie)
  69. Anything You Can Do (2019/Isla Sinclair)
  70. Mourning Meal (2019/Jamal Hodge)
  71. La Casa (2019/Jorge Olguín)
  72. Sahara Hellen: El Regreso del Vampiro (2019/Roger Asto Leon)
  73. Axiom (2019/Dimitri Voutsinos)
  74. Goodbye Mary (2019/Eva María Fernández)
  75. Punkin (2019/Carrie Keagan)
  76. The Knot (2019/Rebecca Schwab)
  77. Dreamcatcher (2019/Jacob Johnston)
  78. Indolence (2019/8m/Aidan Weaver)
  79. The Humming (2019/Austin Bitikofer and Jermaine Nix)
  80. With The Right Conditions (2019/Emma Jayne Lloyd and Sam Mason-Bell)
  81. The Truth Will Out (2019/Jessica Hunt and Sam Mason-Bell)
  82. More Scary Stories to Tell in the Dark: Something Was Wrong (2019/Steven Porras)
  83. Kaaku? (2019/Mohamed Aboobakuru)
  84. Darkfruit (2019/23m/Maria Wilson)
  85. Trakt X (2019/Dino Stahl)
  86. Stitched to Perfection (2019/Jeremy Berg)
  87. Eat Me Out (Of House and Home) (2019/Damon Rickard)
  88. Twelve Gauge Garden (2019/James Wakileh)
  89. Endgame (2019/Magalie de Genova)
  90. Lullaby (2019/Sevag Aksu)
  91. Fused (2019/Patrick Rea)
  92. Killer Date (2019/Colton Tran)
  93. Unicorn (2019/Harry Crossman)
  94. Viola (2019/Paul W. Franklin)
  95. Threshold (2019/Powell Robinson and Patrick Robert Young)
  96. Kathaputali (2019/90m/Veemsen Lama)
  97. Tam Lin (2019/Sean Mo Williams)
  98. Housekreeping (2019/Kyle Dunbar)
  99. You Too, Chuckles (2019/Kevin Hartford)
  100. Teddy (2019/Mark Clauburg)
  101. Necro-Sexual (2019/Brian Rosin)
  102. The Rejected (2019/60m/Onur Dogan)
  103. The Garlic Bulb Challenge (2019/Brian Carlin)
  104. Trapped (2019/Billy Chizmar)
  105. Mama's Boy (2019/James L. Edwards)
  106. Blood from the Shoulder of Pallas (2019/16m/Scott Morris)
  107. Dwellers: The Curse of Pastor Stokes (2019/DeShon Hardy)
  108. The Killer Plumber 2 (2019/Ross Heath and Chris John Livermore)
  109. Lethal Procedures (2019/Jahmar Hill)
  110. Continuance (2019/Tony Olmos)
  111. Fear PHarm (2019/Dante Yore)
  112. Jerky (2019/18 min/Greg Dodder, Russell Wilhite)
  113. The Curse of Halloween Jack (2019/85m/Andrew Jones)
  114. Dolly (2019/Alex Kontakos)
  115. Separation (2019/William Brent Bell)
  116. Gas Gets In Your Eyes (2019/13m/Madeline Leshner)
  117. Ghost Tour (2019/Joey Mosca)
  118. Morbid Colors (2019/Matthew Packman)
  119. Dark Light (2019/Padraig Reynolds)
  120. The Awakening of Lilith (2019/Steven Adam Renkovish)
  121. The Fallen Woman (2019/30m/Kelly Smith)
  122. The Camping Discovery (2019/Jamie Franz Hoover)
  123. The Special (2019/94m/B. Harrison Smith)
  124. Hidden Gene (2019/Jade Hassett)
  125. Buru (2019)
  126. Andhaghaaram (2019/V. Vignarajan)
  127. Find A Penny (2019/Shaun Swift)
  128. 19 Willock Place (2019/82m/John Justice)
  129. To Kill the Dragon (2019/Jimena Monteoliva)
  130. Fire Girls (2019/9m/Chell Stephen)
  131. Homocide (2019/Alex Dickerson)
  132. Nicole, her Ex & the Killer (2019/Bob Akins)
  133. Darlin (2019/Jackson Brown)
  134. The Fires of Soledad (2019/16m/Daniel Eduvijes Carrera)
  135. Death Trap (2019/Deandra Spinner)
  136. After School Lunch Special (2019/Andrew J Chambers)
  137. Return to Clark County (2019/Shawn Uebele)
  138. Come Be Creepy With Us (2019/Elizabeth Fletcher)
  139. Sick Minded (2019/LeVar Leo)
  140. Hall (2019/Francesco Giannini)
  141. Everybody Gets Stabbed (2019/Levon J. Polinelli)
  142. Beautiful Day (2019/TJ Marchbank)
  143. Killer Therapy (2019/Barry Jay)
  144. Bottom Feeders (2019/Nicholas W. Callais)
  145. Bliss (2019/Joe Begos)
  146. Girl on the Third Floor (2019/Travis Stevens)
  147. Koud Licht (2019/Michael van Den Eynde)
  148. Not For The Faint Hearted (2019/Stuart Stanton)
  149. Broil (2019/E.J. Drake)
  150. When She Wakes (2019/91m/David Arthur Clark)
  151. The Light (2019/Zack Inglis)
  152. There He Is Now (2019/Jörg Viktor Steins-Lauss)
  153. Sweet Taste of Souls (2019/Terry Ross)
  154. The Recovery Call (2019/Blake Rice)
  155. Under the Bed (2019/Justin Nelson)
  156. Conversion Therapist (2019/20m/Bears Rebecca Fonté)
  157. SOS (2019/Bryan Martin)
  158. Vampires Vs. the Bronx (2019/Osmany Rodriguez)
  159. Project Aegis - Angel In The Ashes (2019/Rode Ferland)
  160. Murderabiliac (2019/Richard Karpala)
  161. Slender's Park Chapter II (2019/Matteo Finozzi)
  162. Shortcut (2019/Alessio Liguori)
  163. The Girl Upstairs (2019/Kristopher Wile)
  164. The House of Locke (2019/Tony London)
  165. Dead End (2019/30m/Victor Gaspar)
  166. Human Hibachi (2019/Mario Cerrito III)
  167. Unleashing the Demons (2019/Callum Knox)
  168. Gustav D. (2019/Nikolas Sels)
  169. The Hunt (2019/Aaron Mirtes)
  170. Divination (2019/Er Guan)
  171. Torment (2019/Eddie Poletto)
  172. Dorcha (2019/Tharun Mohan)
  173. The Jäger Within (2019 Post-production/Ivan King and Francesco Sanseverino)
  174. Churi (2019/Carlos Pino)
  175. Hush Little Baby: Welcome To The Family 2 (2019/Jonathan Hamblin)
  176. Ouija Mummy (2019/Sébastien Godin)
  177. Adam (2019/Gemma Paul)
  178. In the Dark (2019/Adam King)
  179. Cryo (2019/Barrett Burgin)
  180. Stakeout (2019/John Otteni and Paul Otteni)
  181. Don't Move (2019/Cassie Hay)
  182. The Lady of Silence (2019/Wes Sutton)
  183. Violet (2019/Madeline Graham and Christopher Whiteside)
  184. Yes, Mother (2019/Jennifer Enskat and Cynthia Gray)
  185. Hannah (2019/Jacob Kiesling)
  186. Bad Witch (2019/Victor Fink and Joshua Land)
  187. Midsommar (2019/Ari Aster)
  188. Her Lips are Mine (2019/Ken Cohen)
  189. Butchers (2019/Adrian Langley)
  190. Hungry Joe (2019/Samuel Dawe and Paul Holbrook)
  191. Edgar Allen Poe's Ligeia (2019/100m/Griffith Mehaffey)
  192. El Vestido (2019/Roque Falabella)
  193. Monstrum (2019/Anthony Pernicka)
  194. Washed (2019/9m/Michael Bartolomeo)
  195. Becky (2019/Lane Fobbs)
  196. Space (2019/91m/Monte Light)
  197. I Trapped the Devil (2019/Josh Lobo)
  198. Blood lots (2019/Rode Ferland)
  199. Roach (2019/Trent A Johnson)
  200. The Dead Don't Die (2019/Jim Jarmusch)
  201. Teacher's Lounge (2019/Josh Mruz)
  202. Child's Play (2019/Lars Klevberg)
  203. Museum Madness (2019/Joseph Dutra)
  204. Interment (2019/61m/Sean Murray)
  205. Handy Dandy (2019/Jeff Broadstreet)
  206. Bannister DollHouse (2019/Mj Dixon)
  207. The Utah Cabin Murders (2019/85m/Andrew Jones)
  208. Blood Money (2019/45m/Chas Burns)
  209. Let's Scare Julie to Death (2019/Jud Cremata)
  210. Pay to Stay (2019/12m/Heather Taylor)
  211. Satanic Panic (2019/Chelsea Stardust Peters)
  212. Neuroxica (2019/Cameron Dozier)
  213. Night Mistress (2019/Philip Cable)
  214. A Psycho's Path (2019/Rocky Costanzo)
  215. Porno (2019/98m/Keola Racela)
  216. A Giant Without a Head! (2019/80m/Jorge Xolalpa, Jr.)
  217. Occurrence at Mills Creek (2019/Don Swanson)
  218. Patients of a Saint (2019/Russell Owen)
  219. The Heiress (2019/Chris Bell)
  220. Darlin' (2019/Pollyanna McIntosh)
  221. Miss Janet (2019/Stephen Mickelsen)
  222. Queen of Spades: The Looking Glass (2019/Aleksandr Domogarov)
  223. Attic (2019 Post-production/Ronnie Minder)
  224. Crawl (2019/Alexandre Aja)
  225. Get Gone (2019/91m/Michael Thomas Daniel)
  226. Untitled Annabelle Film (2019/Gary Dauberman)
  227. The Last Frankenstein (2019/David Weaver)
  228. Tone-Deaf (2019/Richard Bates, Jr.)
  229. Best Actress (2019/8m/Sadrak Zmork)
  230. The Sleep Experiment (2019/John Farrelly)
  231. Slash (2019/Jonathan Rowan)
  232. The Faceless Man (2019/James Di Martino)
  233. Victim of love (2019/Jesper Isaksen)
  234. The Invader (2019/Anthony Ashmore)
  235. Do Not Reply (2019/Daniel Woltosz and Walter Woltosz)
  236. Follow Me (2019/Will Wernick)
  237. 3 from Hell (2019/Rob Zombie)
  238. The Seven (2019/Richard Colton)
  239. Millennial Killer (2019/Sam Mason-Bell)
  240. Howl (2019/Michele Martin)
  241. Room 9 (2019/Thomas Walton)
  242. Kanchana 3 (2019/Lawrence Raghavendra)
  243. Twins (2019/Lamberto Bava)
  244. A Last Laugh (2019/Chris Marciante)
  245. Baba Yaga: Terror of the Dark Forest (2019/Svyatoslav Podgaevskiy)
  246. The Lighthouse (2019/Robert Eggers)
  247. Silver Stars on Red Velvet (2019/70m/RJ Cusyk)
  248. Expira (2019/Leopoldo Laborde)
  249. Ma (2019/Tate Taylor)
  250. Delphine (2019/Fábio Brandão)
  251. Life After Man (2019/Gareth Carr)
  252. The Purple Iris (2019/Arif Khan)
  253. Toof (2019/Louisa Warren)
  254. The Last House on Wilkins Street (2019/4m/Cody Kuehn)
  255. Soul Catcher (2019/Melody Tash)
  256. Awoken (2019/95m/Daniel J. Phillips)
  257. Red 11 (2019/77m/Robert Rodriguez)
  258. Dead Space (2019/125m/Diego Palma)
  259. Home with a View of the Monster (2019/Alex Greenlee and Todd Greenlee)
  260. Ground Floor (2019/George Henry Horton)
  261. Brightburn (2019/David Yarovesky)
  262. Hacksaw (2019/75m/Anthony Leone)
  263. The Remnant (2019/17m/Navin Ramaswaran)
  264. The Night They Knocked (2019/Sean F. Roberts, Jr.)
  265. The Format (2019/Vimalraj Jayaseelan)
  266. Made Vicious (2019/David Prindle)
  267. Infernum (2019/Dutch Marich)
  268. Kill Me If You Can... (2019/11m/Katheryn R. Bryant)
  269. Witch Tales (2019/Mike Lyddon)
  270. The House Next Door (2019/Deon Taylor)
  271. Into the Night (2019/Walter Perez)
  272. The Dawn (2019/90m/Brandon Slagle)
  273. Her Name Was Christa (2019/James L. Edwards)
  274. Doll Cemetery (2019/Steven M. Smith)
  275. The Harbinger (2019/Will Klipstine)
  276. The Krampus Carol (2019/87m/Jake Zelch)
  277. The Ghost Outside (2019/Jazz Virk)
  278. Nice Mike (2019/Kelly Smith)
  279. It: Chapter Two (2019/Andy Muschietti)
  280. 47 Meters Down: Uncaged (2019/Johannes Roberts)
  281. AQUASLASH (2019/Renaud Gauthier)
  282. Mother and Daughter (2019 Post-production/Ricardo Santos)
  283. Irl (2019/Jennifer Harrington)
  284. Aiyai: Wrathful Soul (2019/116m/Ilanthirayan Alan Arumugam)
  285. Acid Pit Stop (2019/Jason Wright)
  286. 3 Days (2019/90m/Kristina Aponte and Jose Hernandez)
  287. Final Cutz (2019/Liam Lockhart)
  288. Deadly Callback (2019/Scott Jeffrey)
  289. Nuns: An Italian Horror Story (2019/Giovanni Aloisio)
  290. Blood Tulips (2019/Randy Kent and John Luksetich)
  291. Blood of Drago (2019/90m/Homer Broadnax)
  292. Morte à l'avance (2019/45m/Raphael Desbordes)
  293. Cherrypicker (2019/Bennet De Brabandere)
  294. One for the Road (2019/Joseph Horning)
  295. Coven (2019/Margaret Malandruccolo)
  296. C.L.E.A.N. (2019/Aurelio Toni Agliata)
  297. No Sin Unpunished (2019/Matt Green)
  298. HEN (2019 Post-production/Janna Kemperman)
  299. Yuraq (2019/110m/Pierre Taisne)
  300. HAGER (2019/Kevin Kopacka)
  301. Wait for It (2019/12m/David J. Stieve)
  302. Scavengers (2019/Oliver Griffiths)
  303. Angela (2019/Chris Bucher and Severin Gmünder)
  304. The Sleep (2019/Devin Rice)
  305. Fingers (2019/87m/Juan Ortiz)
  306. Kill Dolly Kill (2019/Heidi Moore, Daniel Murphy and Tony Walters)
  307. Malady (2019/85m/Nick Kane and Brian Frank Visciglia)
  308. Whisper (2019/Christopher Jolley)
  309. The Dare (2019/Giles Alderson)
  310. Behind the Sightings (2019/Tony Cadwell)
  311. Candy Corn (2019/Josh Hasty)
  312. My Little Baby (2019/Giorgio Bruno)
  313. Paranormal Worlds: Based On True Events (2019/120m/Sanjay Sharma)
  314. Schism (2019/Michael Storch)
  315. The Clouding (2019/Dorian Louis)
  316. Z (2019/Brandon Christensen)
Completed and set for release sometime within 2019
  1. Side-B (2019/10m/Vanessa Williams)
  2. Shapes (2019/4m/Dhruv Suri)
  3. Keeper (2019/7m/James Mentzinger)
  4. Out from Within (2019/12m/Vincenzo Nappi)
  5. Edge of the Woods (2019 Video/12m/Phranque Wright)
  6. Deliver Us (2019/12m/Kevin McCormack)
  7. Auopssessed (2019/8 min/Emil Levin)
  8. Return (2019/19m/Sangwon Park)
  9. Messed Up (2019/Lucé Tomlin-Brenner
  10. Mateo (2019/4m/Fernando Perezgil)
  11. Hear Me (2019/Jesse Haaja)
  12. If Not for my Demons (2019/12m/Kenneth Ryan)
  13. Headcleaner (2019/Nick Scott)
  14. Dust to Dust (2019/9m/Mitch Urban)
  15. Sticky (2019/3m/ Completed/Ashley Good)
  16. Finley (2019/25m/J. Zachary Thurman)
  17. Sub Umbra (2019/19m/René Schweitzer)
  18. Flesh (2019/25m/Poon Tsz Yin)
  19. Furniture (2019/6m/George A. Pitsilos)
  20. Delivery (2019/Brad Milne)
  21. The Smiling Strangers (2019 Video/5m/Tom Bragg)
  22. Cached (2019/13m/Daniel Lake)
  23. Parasite (2019/Michael Davis Fármako)
  24. Kushtaka (2019/15m/Cameron Currin)
  25. L.A. Haunted (2019/15 min Completed/Arthur Mountaniol)
  26. Baby (2019/8m/Anthony Leone)
  27. The Terrible Old Man (2019/Tyler McAlister)
  28. Black Cat In A Dark Room (2019/15m/Leland Montgomery)
  29. Dark Christmas (2019/Unrated Completed/Manny Velazquez)
  30. Jeanine (2019/Mike Villani)
  31. Nightshocker (2019/7m/Donald Zirlin)
  32. The Phone Dead (2019/4 min/Josh Hoffman)
  33. 8 Ball Clown II (2019/97m/Erik Kristopher Myers)
  34. Still Water (2019/5m/Ryan Kramer)
  35. The Allendale Curse (2019/84m/Matondo Kiantandu)
  36. The Dark Recess (2019/Oliver Jolliffe)
  37. Eiga: Toshimaen (2019/81m/Hiroshi Takahashi)
  38. Revenge of the Pontianak (2019/92m/Glen Goei)
  39. Pig (2019/8 min Completed/Evan Powers)
  40. Deep Tissue (2019/9m/ Completed/Meredith Alloway
  41. Opening the Mind (2019/115m/Michael Todd Schneider)
  42. Cleavers: Killer Clowns (2019/Mj Dixon)
  43. The Dreamer (2019/14m/Kenneth Karlstad)
  44. Crazy 2 Crazy (2019/92m/Greg Daniel)
  45. Mushkil (2019/130m/Rajiv S. Ruia)
  46. Baby (2019/8m/Mark Melville)
  47. Requiem (2019/5m/Daniel Abatan and Thomas R. Burke)
  48. The Secret Game (Dating App) (2019/Raaw Horan)
  49. Piano (2019/Richard Schertzer)
  50. The Unspoken Sin (2019/Marvin J. Harrell)
  51. Sacren (2019/83m/Alexander Henderson)
  52. Il signor Diavolo (2019/Pupi Avati)
  53. Watched (2019/15m/Joshy Lee)
  54. Repossession (2019/Ming Siu Goh and Scott C. Hillyard)
  55. How to Be Alone (2019/11m/Kate Trefry)
  56. Countdown to Midnight (2019/13m/Dan Sellers)
  57. Rubes (2019/7 min/Nathan Alan Bunker)
  58. Robert Reborn (2019/85m/Andrew Jones)
  59. Limbo (2019/David Barrera)
  60. The Horror of Making My Film (2019/79m/Kyan Kiani)
  61. J'Tree (2019/33m/Anthony Ficco)
  62. Phonomanie (2019/90m/Mr. Zito)
  63. The Haunting of Sharon Tate (2019/Daniel Farrands)
  64. The Super (2019/Emeson Nwolie)
  65. House Of Setnakht (2019/95m/Ahmed Aqle and Asmaa Abdel Nabe)
  66. Hallowed Ground (2019/117m/Miles Doleac)
  67. Hellbox II: A Dimensão Negra (2019/25m/Rui Constantino)
  68. Blood Craft (2019/94m/James Cullen Bressack)
  69. Killerhertz (2019/Colin Bishop)
  70. The Massacre on Cielo Drive (2019/90m/Andrew Jones)
  71. Art of the Dead (2019/Rolfe Kanefsky)
  72. Straight Edge Kegger (2019/Jason Zink)
  73. Return of the Slasher (2019/Anthony Ashmore)
  74. Xpiation (2019/90m/Domiziano Cristopharo)
  75. 13 Graves (2019/John Langridge)
  76. Willa (2019/12m/Corey Mayne)
  77. The Gallows Act II (2019/Travis Cluff and Chris Lofing)
  78. One Remains (2019/90m/Josh Hodgins)
  79. The Silence (2019/PG-13/John R. Leonetti)
  80. Nun's Deadly Confession (2019/Stuart Paul)
  81. (Hashtag)Followme (2019/90m/Sam Hardy)
  82. Menantico Blues (2019/Ricky Whitehead)
  83. Paranoia Tapes 2: Press Play (2019/Steven Daemers, Stephen Gallen, Douglas A. Plomitallo, Maurice Hooks and Brad Ryal)
  84. Triggered (2019/114m/Chris Moore)
  85. Ghost in the Graveyard (2019/Charlie Comparetto)
  86. Restricted Area (2019/Christopher M. Don)
  87. Us (2019/120m/Jordan Peele)
  88. Fading Flowers (2019/90m/Jeffrey Schneider)
  89. Preparation (2019/Mark Clauburg)
  90. On Halloween (2019/92m/Timothy Boyle)
  91. The Maya Tape (2019/100m/Nikhil Allug)
  92. The Luring (2019/95m/Christopher Wells)
  93. Possession Diaries (2019/93m/Juan Frausto)
  94. Psychedelic Psychopaths (2019/Tom Zarzecki)
submitted by tombstoneshadows28 to horror [link] [comments]


2018.08.18 17:31 justinflyby 'The Ninth Passenger (2018)' Trailer - Starring Alexia Fast, Jesse Metcalfe. From the executive producer of 'It Follows' - Release Date 21 August 2018.

submitted by justinflyby to horror [link] [comments]


2018.06.13 01:58 peterboykin Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!

Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!
Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!HAPPPPPPY SATURDAY, PATRIOTS!This is your girl u/IvaginaryFriend back at it again with a weeks worth of spice for you lovely Deplorables! (◠‿◠✿)Before we officially get this recap started, if you happened to miss any past recaps you can catch them here!Also, don't forget about our Header contest coming up on Monday, June 11th!!! The winning submission will be proudly presented at the top of the DOM for the next few months!!!Now, let's get on with the show!Sunday, June 3rd:🔥🔥TRUMP TWEETS🔥🔥:Jesse Watters “The only thing Trump obstructed was Hillary getting to the White House.” So true!As only one of two people left who could become President, why wouldn’t the FBI or Department of “Justice” have told me that they were secretly investigating Paul Manafort (on charges that were 10 years old and had been previously dropped) during my campaign? Should have told me!....Paul Manafort came into the campaign very late and was with us for a short period of time (he represented Ronald Reagan, Bob Dole & many others over the years), but we should have been told that Comey and the boys were doing a number on him, and he wouldn’t have been hired!Mark Penn “Why are there people from the Clinton Foundation on the Mueller Staff? Why is there an Independent Counsel? To go after people and their families for unrelated offenses...Constitution was set up to prevent this...Stormtrooper tactics almost.” A disgrace!SIGNIFICANT TWEETS AND NEWS:WINNING! U.S. Beats Singapore & Hong Kong To Become The World's Most Competitive Economy Again - #MAGA!Roseanne Barr is off TV but Samantha Bee is still on -- just another example of the media’s double standardThis timeline is unexpected. In 2018, I have already skipped a Star Wars movie in the theatres and paid money for a Kanye West Album.THE MADMAN-Probably the best quote in human history to date🐸 TOP SPICE OF THE DAY 🐸:"oh they're so good, oh they're so sweet."Today is Trump's 500th day as POTUS so here is a commemorative $500 bill.This triggers leftists.FITTON: My first official meme for the TD"Cuz we hate him"Monday, June 4th:TODAY'S ACTION:Vice President Pence Delivers Remarks at a Reception Promoting a Hemisphere of FreedomPresident Donald J. Trump Announces Intent to Nominate Personnel to a Key Administration PostPresidential Memorandum for the Secretary of StatePresidential Memorandum for the Secretary of StateEight Nominations Sent to the Senate Today🔥🔥TRUMP TWEETS🔥🔥:This is my 500th. Day in Office and we have accomplished a lot - many believe more than any President in his first 500 days. Massive Tax & Regulation Cuts, Military & Vets, Lower Crime & Illegal Immigration, Stronger Borders, Judgeships, Best Economy & Jobs EVER, and much more... ....We had Repeal & Replace done (and the saving to our country of one trillion dollars) except for one person, but it is getting done anyway. Individual Mandate is gone and great, less expensive plans will be announced this month. Drug prices coming down & Right to Try!“This is the best time EVER to look for a job.” James Freeman of WSJ.As has been stated by numerous legal scholars, I have the absolute right to PARDON myself, but why would I do that when I have done nothing wrong? In the meantime, the never ending Witch Hunt, led by 13 very Angry and Conflicted Democrats (& others) continues into the mid-terms!China already charges a tax of 16% on soybeans. Canada has all sorts of trade barriers on our Agricultural products. Not acceptable!The U.S. has made such bad trade deals over so many years that we can only WIN!Farmers have not been doing well for 15 years. Mexico, Canada, China and others have treated them unfairly. By the time I finish trade talks, that will change. Big trade barriers against U.S. farmers, and other businesses, will finally be broken. Massive trade deficits no longer!The appointment of the Special Counsel is totally UNCONSTITUTIONAL! Despite that, we play the game because I, unlike the Democrats, have done nothing wrong!#500Days of American Greatness: http://45.wh.gov/gNWs8uThe Fake News Media is desperate to distract from the economy and record setting economic numbers and so they keep talking about the phony Russian Witch Hunt.In many ways this is the greatest economy in the HISTORY of America and the best time EVER to look for a job!Big Supreme Court ruling for Baker just out!The Philadelphia Eagles Football Team was invited to the White House. Unfortunately, only a small number of players decided to come, and we canceled the event. Staying in the Locker Room for the playing of our National Anthem is as disrespectful to our country as kneeling. Sorry!SIGNIFICANT TWEETS AND NEWS:Supreme Court rules 7-2 in favor of Colorado baker who refused to bake a wedding cake for a gay couple on religious grounds. SCOTUS finds that the Colorado Civil Rights Commission did not consider this case with religious neutrality and violated the Free Exercise Clause.Stand for the Anthem or don’t come. I love this President.Watch Bernie Sanders Run From Alex Jones At LAX Airport29 Years ago Today. This is Communism. Never Forget.The media was all about an outgoing Obama pardoning Incoming Hillary. Then they were cool with Hillary pardoning herself. But now, because it’s DJT, now it’s a “constitutional crisis.” Sorry ass complicit jerk-offs.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:worst boycott ever #MAGAJust saw this on another sub. Pretty accurate tbhThis is America.BREAKING: In a narrow 2,623-487 county decision, Trump wins the US electionBREAKING: In narrow 77-0 decision, Oklahoma goes entirely Republican.Tuesday, June 5th:TODAY'S ACTION:President Trump Participates in the Celebration of AmericaHerschel Walker at the White House Sports and Fitness DayNatalie Gulbis at the White House Sports and Fitness DayPresident Trump Participates in the Signing Ceremony for S. 292🔥🔥TRUMP TWEETS🔥🔥:What is taking so long with the Inspector General’s Report on Crooked Hillary and Slippery James Comey. Numerous delays. Hope Report is not being changed and made weaker! There are so many horrible things to tell, the public has the right to know. Transparency!The U.S. has an increased economic value of more than 7 Trillion Dollars since the Election. May be the best economy in the history of our country. Record Jobs numbers. Nice!We will proudly be playing the National Anthem and other wonderful music celebrating our Country today at 3 P.M., The White House, with the United States Marine Band and the United States Army Chorus. Honoring America! NFL, no escaping to Locker Rooms!We have had many Championship teams recently at the White House including the Chicago Cubs, Houston Astros, Pittsburgh Penguins, New England Patriots, Alabama and Clemson National Champions, and many others. National Anthem & more great music today at 3:00 P.M.The Russian Witch Hunt Hoax continues, all because Jeff Sessions didn’t tell me he was going to recuse himself...I would have quickly picked someone else. So much time and money wasted, so many lives ruined...and Sessions knew better than most that there was No Collusion!Meeting in Singapore with North Korea will hopefully be the start of something big...we will soon [email protected] and Champion @MartinTruex_Jr were recently at the White House. It was a great day for a great sport!Separating families at the Border is the fault of bad legislation passed by the Democrats. Border Security laws should be changed but the Dems can’t get their act together! Started the Wall.In High Tax, High Crime California, be sure to get out and vote for Republican John Cox for Governor. He will make a BIG difference!Get the vote out in California today for Rep. Kevin McCarthy and all of the great GOP candidates for Congress. Keep our country out of the hands of High Tax, High Crime Nancy Pelosi.Vote for Congressman Devin Nunes, a true American Patriot the likes of which we rarely see in our modern day world....he truly loves our country and deserves everyone’s support!Senator @RogerWicker of Mississippi has done everything necessary to Make America Great Again! Get out and vote for Roger, he has my total support!Terrific new book out by the wonderful Harris Faulkner, “9 Rules of Engagement.” Harris shares lessons from a military family. Enjoy!The HISTORIC Rescissions Package we’ve proposed would cut $15,000,000,000 in Wasteful Spending! We are getting our government back on track.Imagine how much wasteful spending we’d save if we didn’t have Chuck and Nancy standing in our way! For years, Democrats in Congress have depleted our military and busted our budgets on needless spending, and to what end? No more.Wow, Strzok-Page, the incompetent & corrupt FBI lovers, have texts referring to a counter-intelligence operation into the Trump Campaign dating way back to December, 2015. SPYGATE is in full force! Is the Mainstream Media interested yet? Big stuff!(Retweeting Robby Starbuck) Fox News has been #1 for 197 months straight. In the latest ratings disaster for CNN they lost another 25% of their viewers. Fox has 10 of the top 15 shows and even hold the #1 spot in the younger key demo. The public is loudly rejecting @CNN.(Retweeting Eric Trump) #MakeAmericaGreatAgain 🇺🇸🇺🇸🇺🇸(Retweeting Brad Parscale) Since the #FakeNews is full of distortions, underreporting, and lies, we launched a platform tonight presenting a comprehensive record of @realDonaldTrump’s administration. The truth will be told about a remarkable 500-day record of accomplishments!Great interview by @LouDobbs with Chris Farrell of Judicial Watch concerning the governments counter-intelligence operation into the Trump Campaign. SPYGATE at the highest level. Who would believe? 10,534 replies 12,776 retweets 50,227 likesChris Farrell, Judicial Watch. “They were running an operation to undermine a candidate for President of the U.S. These are all violations of law. This is intelligence tradecraft to steer an election. There’s nothing more grave when it comes to abuse of our intelligence system... ... ...This is a level of criminality beyond the pale. This is such a grave abuse of power and authority, it’s like nothing else we’ve seen in our history. This makes the Nixon Watergate burglary look like keystone cop stuff....The greatest Witch Hunt in political history!Mitch McConnell announced he will cancel the Senate’s August Recess. Great, maybe the Democrats will finally get something done other than their acceptance of High Crime and High Taxes. We need Border Security!SIGNIFICANT TWEETS AND NEWS:For the first time in recorded American history the U.S. Department of Labor reports: Job openings exceed number of job seekers. (That.... Mr Obama is a fucking magic wand)TRUMP ON MIDTERMS: WE CANNOT BE COMPLACENT. GET OUT AND VOTE AL, IA, MS, MT, NJ, NM & SD!!Page/Strokz emails including the changing of the verbiage to exhonerate ClintonAndrew McCabe seeks immunity for testimony in congressional hearingTHIS IS YUUUUUUGE:U.S. Senate Majority Leader Mitch McConnell canceled the Senate's traditional August recess, citing Democrats' "historic obstruction" to pass legislation.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:The Blue Wave. Proof. It's Happening. The Democrats are "unstoppable".Different kids of diets😂 This past weekend #Antifa came out to play in the Pacific Northwest and did they ever get a surprise!GeniusDon't let the world forget KateTfw the OIG is taking so long with the report on Crooked Hillary and Slippery James ComeyWednesday, June 6th:TODAY'S ACTION:President Trump Participates in the Signing Ceremony for S. 2372 – VA Mission Act of 2018President Trump Signs VA Mission Act of 2018 into LawPresident Trump and Vice President Pence Attend the 2018 Hurricane Briefing at FEMA HQPresident Trump Delivers Remarks After the 2018 Hurricane Briefing at FEMA HQPresident Trump Hosts the White House IFTARPresident Donald J. Trump Announces Intent to Nominate and Appoint Personnel to Key Administration PostsPresident Donald J. Trump Announces Appointments for the Executive Office of the President🔥🔥TRUMP TWEETS🔥🔥:Great night for Republicans! Congratulations to John Cox on a really big number in California. He can win. Even Fake News CNN said the Trump impact was really big, much bigger than they ever thought possible. So much for the big Blue Wave, it may be a big Red Wave. Working hard!Gold Star father, Ceejay Metcalf, whose great son Michael was just honored at the White House, was fantastic this morning on @foxandfriends. He is a special man!The Fake News Media has been so unfair, and vicious, to my wife and our great First Lady, Melania. During her recovery from surgery they reported everything from near death, to facelift, to left the W.H. (and me) for N.Y. or Virginia, to abuse. All Fake, she is doing really well!...Four reporters spotted Melania in the White House last week walking merrily along to a meeting. They never reported the sighting because it would hurt the sick narrative that she was living in a different part of the world, was really ill, or whatever. Fake News is really bad!Many more Republican voters showed up yesterday than the Fake News thought possible. The political pundits just don’t get what is going on out there - or they do get it but refuse to report the facts! Remember, Dems are High Tax, High Crime, easy to beat!Congratulations to Dana Rohrabacher on his big California win. We are proud of you Dana!Today we mark another milestone: the 74th anniversary of #DDay, the Allied invasion of Normandy. On June 6, 1944, more than 70,000 brave young Americans charged out of landing craft, jumped out of airplanes, and stormed into hell...We must always protect those who protect us. Today, it was my great honor to sign the #VAMissionAct and to make Veterans Choice the permanent law of the land! http://45.wh.gov/dyWJNqThank you to everyone at @FEMA HQ for today’s briefing on preparations for the upcoming hurricane season. Disaster response and recovery is best achieved when it’s federally supported, state managed, and locally executed – this is the successful model we will continue to build.SIGNIFICANT TWEETS AND NEWS:Seventy-four years ago today American patriots fought and died by the thousands to stop real fascism, racial genocide, and oppression. Let's remember these brave Americans who gave it all so Soy Boys today can claim every patriotic American is a fascist and racist without a hint of irony. D-Day 44Steve Scalise back on the field today.BOMBSHELL REPORT: The Obama administration granted a license letting Iran access the United States financial system despite officials’ pledges that they would prohibit itPromisesKept.com President Donald J. Trump's AccomplishmentsHenry Winkler says he was among 118,000 voters 'left off' Los Angeles County rosters Fox NewsThe Most Ignored Bombshell of 2017: Samantha Power was caught using her security clearance as a UN ambassador to review private conversations by U.S. citizens 260 times in the 2016 election year... She said that someone else in the Obama White House did this, using her security clearance.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:This is AmericaThe most important comment I've ever made. If this message resonates with even one person then I will have made the world a better place.Commander of CheeseheadsMiss America crowned in advance! Judges cite her YUGE brains and charity work with mentally impaired media as key factors! Beautiful person!Thursday, June 7th:TODAY'S ACTION:They Said It Couldn't Be DonePresident Trumps Meets with the Prime Minister of JapanPresident Trump Hosts a Joint Press Conference with the Prime Minister of JapanPresident Trump Welcomes Prime Minister Shinzō Abe of Japan to the White House[]()🔥🔥TRUMP TWEETS🔥🔥:Isn’t it Ironic? Getting ready to go to the G-7 in Canada to fight for our country on Trade (we have the worst trade deals ever made), then off to Singapore to meet with North Korea & the Nuclear Problem...But back home we still have the 13 Angry Democrats pushing the Witch Hunt!Good luck to Alice Johnson. Have a wonderful life!Alan Dershowitz, Harvard Law Professor: “It all proves that we never needed a Special Counsel....All of this could have been done by the Justice Dept. Don’t need a multi-million dollar group of people with a target on someone’s back. Not the way Justice should operate.” So true!When and where will all of the many conflicts of interest be listed by the 13 Angry Democrats (plus) working on the Witch Hunt Hoax. There has never been a group of people on a case so biased or conflicted. It is all a Democrat Excuse for LOSING the Election. Where is the server?How could Jeff Flake, who is setting record low polling numbers in Arizona and was therefore humiliatingly forced out of his own Senate seat without even a fight (and who doesn’t have a clue), think about running for office, even a lower one, again? Let’s face it, he’s a Flake!Looking forward to seeing my friend Prime Minister @AbeShinzo of Japan at noon. Will be discussing North Korea and Trade.Our Justice Department must not let Awan & Debbie Wasserman Schultz off the hook. The Democrat I.T. scandal is a key to much of the corruption we see today. They want to make a “plea deal” to hide what is on their Server. Where is Server? Really bad!When will people start saying, “thank you, Mr. President, for firing James Comey?”The Obama Administration is now accused of trying to give Iran secret access to the financial system of the United States. This is totally illegal. Perhaps we could get the 13 Angry Democrats to divert some of their energy to this “matter” (as Comey would call it). Investigate!“Total jobless claims running at lowest level in 44 years”“$3 billion payoff: 101 utilities cut rates, credit GOP tax cuts”MAKING AMERICA GREAT AGAIN!It’s my great honor to welcome Prime Minister @AbeShinzo back to the @WhiteHouse!🇺🇸🇯🇵Today, I am greatly honored to welcome my good friend, PM Abe of Japan to the @WhiteHouse. Over the past 16 months the Prime Minister and I have worked closely together to address common challenges, of which there are many...PM Abe and I are also working to improve the trading relationship between the U.S. and Japan, something we have to do. The U.S. seeks a bilateral deal with Japan that is based on the principle of fairness and reciprocity. We’re working hard to reduce our trade imbalance...Great day of meetings with Prime Minister @AbeShinzo of Japan!Please tell Prime Minister Trudeau and President Macron that they are charging the U.S. massive tariffs and create non-monetary barriers. The EU trade surplus with the U.S. is $151 Billion, and Canada keeps our farmers and others out. Look forward to seeing them tomorrow.Prime Minister Trudeau is being so indignant, bringing up the relationship that the U.S. and Canada had over the many years and all sorts of other things...but he doesn’t bring up the fact that they charge us up to 300% on dairy — hurting our Farmers, killing our Agriculture!Why isn’t the European Union and Canada informing the public that for years they have used massive Trade Tariffs and non-monetary Trade Barriers against the U.S. Totally unfair to our farmers, workers & companies. Take down your tariffs & barriers or we will more than match you!SIGNIFICANT TWEETS AND NEWS:OUTRAGEOUS! New IG Report - Social Security Benefits paid to DACA! Illegals are receiving OUR Social Security Benefits!The Kent State 2A girl is a god-tier shitposter.MSNBC Calls Daughter Of Pardoned Alice Johnson — She Can’t Stop Thanking TrumpTime Magazine honors Trump again!!! Beautiful cover. The left can’t meme.LOL! Sean Hannity is trending on Twitter because he jokingly told "witnesses" to smash their phones with hammers before handing them over to Mueller. Stupid Liberals are saying he is tampering with evidence. They probably dont know thats what Hillary actually did.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:This is AmericaGrandfather was born a slave, mother was born a refugee, I was born freeThere are only 2 genders, and if you disagree then you're an Islamophobe. Leftist SJWs BTFO!Mirror, Mirror on THE WALL, who's the WOKEST of us ALL??Friday, June 8th:TODAY'S ACTION:President Donald J. Trump Proclaims June 14, 2018 as Flag Day and the Week Starting June 10, 2018 as National Flag WeekPresident Trump Delivers a Statement Upon DeparturePresident Trump Participates in an Expanded Bilateral Meeting with the Prime Minister of CanadaPresident Trump Participates in a Bilateral Meeting with the President of the French Republic🔥🔥TRUMP TWEETS🔥🔥:Obama, Schumer and Pelosi did NOTHING about North Korea, and now weak on Crime, High Tax Schumer is telling me what to do at the Summit the Dems could never set up. Schumer failed with North Korea and Iran, we don’t need his advice!Canada charges the U.S. a 270% tariff on Dairy Products! They didn’t tell you that, did they? Not fair to our farmers!Looking forward to straightening out unfair Trade Deals with the G-7 countries. If it doesn’t happen, we come out even better!Congratulations to the Washington Capitals on their GREAT play and winning the Stanley Cup Championship. Alex Ovechkin, the team captain, was spectacular - a true Superstar! D.C. is popping, in many ways. What a time!I am heading for Canada and the G-7 for talks that will mostly center on the long time unfair trade practiced against the United States. From there I go to Singapore and talks with North Korea on Denuclearization. Won’t be talking about the Russian Witch Hunt Hoax for a while!My thoughts and prayers are with the families of our serviceman who was killed and his fellow servicemen who were wounded in Somalia. They are truly all HEROES.(Retweeting G7 Canada) Day 1 of #G7Charlevoix in 60 seconds.SIGNIFICANT TWEETS AND NEWS:President Trump confirms intent to sign states' rights cannabis bill that was introduced in Congress yesterdayPewdiepie reuploads video exposing CNN and Hillary Clinton after it got copystriked and deleted!BAHAHAHAHAHA.............BAHAJSJSKGLGOGICSteam refuses to bend the knee to SJWs, choosing to stand with community - All content that is legal will be allowed.BREAKING: Trump tells kneeling NFL players to recommend people to pardon, since that's what they're supposedly protesting. Their reason to kneel just died. LOL🐸 TOP SPICE OF THE DAY 🐸:When you're surrounded by globalistsPresstitutesHookers for Hillary, I should have known...ARCHIVE: "Sleeping with your source- especially a vindictive congressman?" - Ali Watkins, 2013Saturday, June 10th:TODAY'S ACTION:President Trump delivers a statementSIGNIFICANT TWEETS AND NEWS:Ali Watkins not getting the probe she had hoped for; Feds have seized her email and phone records for investigation on James Wolfe!HOLY SHIT Last night Bill Maher said what every lefitist truly thinks but might not say out loud: That he HOPES FOR A RECESSION to hurt President Trump. They'd rather see our country fail if it means Trump won't succeed. This is peak Trump derangement, folks. SAD!James Wolfe Leak Investigation: Journalists Insist on a Double Standard - Andrew McCarthyNew italian PM Conte on Facebook: Historic alliance, new friendship 🤝 - Can't get tired of all this winning, MAGA and MIGA!!! 🍝🍔BREAKING: Seth Rich's Brother's Attorneys Subpoena Twitter to Turn Over All Direct Messages from: Wikileaks, Julian Assange, KimDotCom, Cassandra Fairbanks, Gateway Pundit, etc🐸 TOP SPICE OF THE DAY 🐸:The God Emperor and his court JesterUSA and Canada 🇺🇲🇨🇦Not a drill: European Union banning memes (seriously).Dressed up for me best friend Melania.So Much Winning, STILL NOT TIRED OF IT!!As always, some tunes to get you jamming through this long list of winning;Ghost Town4th DimensionNo MistakesWatchWhat Would Meek do?MAGA ON PATRIOTS!Submitted June 09, 2018 at 11:48AM by Ivaginaryfriend https://www.reddit.com/The\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_Donald/comments/8ptnk6/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /The_DonaldSubmitted June 09, 2018 at 12:48PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pu2ln/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pun4d/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 06:13PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pwc8s/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 07:13PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pwpq2/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 08:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pxdfj/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 10:18PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pxu3a/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 11:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pydsj/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 12:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pynsafternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 02:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pz72afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 03:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pzfe1/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 06:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q02kv/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 08:43AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q0jrp/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 09:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q0s8t/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 10:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q1bf2/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 12:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q1y1t/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q2m9o/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 05:28PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q41fu/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 06:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q4hwafternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 08:23PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q57mj/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 09:28PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q5lxs/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 11:48PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q6hj6/afternoon\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 12:18AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q6o1m/afternoon\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 01:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q71kt/afternoon\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 02:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q7hym/afternoon\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 03:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q7sgi/afternoon\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 06:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q8lkv/afternoon\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 08:23AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q93tt/afternoon\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 09:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q9iv4/afternoon\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 10:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qa4xafternoon\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 12:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qavpx/afternoon\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qbjwj/afternoon\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 06:38PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qdrii/afternoon\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\_your\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 08:23PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qehmo/afternoon\\\\\\\\\\\\_magathread\\\\\\\\\\\\_your\\\\\\\\\\\\_weekly\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 09:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qf511/afternoon\\\\\\\\\\\_magathread\\\\\\\\\\\_your\\\\\\\\\\\_weekly\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 11:18PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qfobv/afternoon\\\\\\\\\\_magathread\\\\\\\\\\_your\\\\\\\\\\_weekly\\\\\\\\\\_presidential/?utm\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 01:38AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qghk4/afternoon\\\\\\\\\_magathread\\\\\\\\\_your\\\\\\\\\_weekly\\\\\\\\\_presidential/?utm\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 02:38AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qgspl/afternoon\\\\\\\\_magathread\\\\\\\\_your\\\\\\\\_weekly\\\\\\\\_presidential/?utm\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 07:03AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qi1pi/afternoon\\\\\\\_magathread\\\\\\\_your\\\\\\\_weekly\\\\\\\_presidential/?utm\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 08:13AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qifwi/afternoon\\\\\\_magathread\\\\\\_your\\\\\\_weekly\\\\\\_presidential/?utm\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 09:33AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qiyie/afternoon\\\\\_magathread\\\\\_your\\\\\_weekly\\\\\_presidential/?utm\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 10:43AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qjgyv/afternoon\\\\_magathread\\\\_your\\\\_weekly\\\\_presidential/?utm\\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 12:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qkdu3/afternoon\\\_magathread\\\_your\\\_weekly\\\_presidential/?utm\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 12:53PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qkjs6/afternoon\\_magathread\\_your\\_weekly\\_presidential/?utm\\_source=iftttvia /MagaFirstNews
Submitted June 12, 2018 at 07:03PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qniww/afternoon\_magathread\_your\_weekly\_presidential/?utm\_source=ifttt
via /MagaFirstNews
submitted by peterboykin to MagaFirstNews [link] [comments]


2018.06.13 01:03 peterboykin Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!

Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!
Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!HAPPPPPPY SATURDAY, PATRIOTS!This is your girl u/IvaginaryFriend back at it again with a weeks worth of spice for you lovely Deplorables! (◠‿◠✿)Before we officially get this recap started, if you happened to miss any past recaps you can catch them here!Also, don't forget about our Header contest coming up on Monday, June 11th!!! The winning submission will be proudly presented at the top of the DOM for the next few months!!!Now, let's get on with the show!Sunday, June 3rd:🔥🔥TRUMP TWEETS🔥🔥:Jesse Watters “The only thing Trump obstructed was Hillary getting to the White House.” So true!As only one of two people left who could become President, why wouldn’t the FBI or Department of “Justice” have told me that they were secretly investigating Paul Manafort (on charges that were 10 years old and had been previously dropped) during my campaign? Should have told me!....Paul Manafort came into the campaign very late and was with us for a short period of time (he represented Ronald Reagan, Bob Dole & many others over the years), but we should have been told that Comey and the boys were doing a number on him, and he wouldn’t have been hired!Mark Penn “Why are there people from the Clinton Foundation on the Mueller Staff? Why is there an Independent Counsel? To go after people and their families for unrelated offenses...Constitution was set up to prevent this...Stormtrooper tactics almost.” A disgrace!SIGNIFICANT TWEETS AND NEWS:WINNING! U.S. Beats Singapore & Hong Kong To Become The World's Most Competitive Economy Again - #MAGA!Roseanne Barr is off TV but Samantha Bee is still on -- just another example of the media’s double standardThis timeline is unexpected. In 2018, I have already skipped a Star Wars movie in the theatres and paid money for a Kanye West Album.THE MADMAN-Probably the best quote in human history to date🐸 TOP SPICE OF THE DAY 🐸:"oh they're so good, oh they're so sweet."Today is Trump's 500th day as POTUS so here is a commemorative $500 bill.This triggers leftists.FITTON: My first official meme for the TD"Cuz we hate him"Monday, June 4th:TODAY'S ACTION:Vice President Pence Delivers Remarks at a Reception Promoting a Hemisphere of FreedomPresident Donald J. Trump Announces Intent to Nominate Personnel to a Key Administration PostPresidential Memorandum for the Secretary of StatePresidential Memorandum for the Secretary of StateEight Nominations Sent to the Senate Today🔥🔥TRUMP TWEETS🔥🔥:This is my 500th. Day in Office and we have accomplished a lot - many believe more than any President in his first 500 days. Massive Tax & Regulation Cuts, Military & Vets, Lower Crime & Illegal Immigration, Stronger Borders, Judgeships, Best Economy & Jobs EVER, and much more... ....We had Repeal & Replace done (and the saving to our country of one trillion dollars) except for one person, but it is getting done anyway. Individual Mandate is gone and great, less expensive plans will be announced this month. Drug prices coming down & Right to Try!“This is the best time EVER to look for a job.” James Freeman of WSJ.As has been stated by numerous legal scholars, I have the absolute right to PARDON myself, but why would I do that when I have done nothing wrong? In the meantime, the never ending Witch Hunt, led by 13 very Angry and Conflicted Democrats (& others) continues into the mid-terms!China already charges a tax of 16% on soybeans. Canada has all sorts of trade barriers on our Agricultural products. Not acceptable!The U.S. has made such bad trade deals over so many years that we can only WIN!Farmers have not been doing well for 15 years. Mexico, Canada, China and others have treated them unfairly. By the time I finish trade talks, that will change. Big trade barriers against U.S. farmers, and other businesses, will finally be broken. Massive trade deficits no longer!The appointment of the Special Counsel is totally UNCONSTITUTIONAL! Despite that, we play the game because I, unlike the Democrats, have done nothing wrong!#500Days of American Greatness: http://45.wh.gov/gNWs8uThe Fake News Media is desperate to distract from the economy and record setting economic numbers and so they keep talking about the phony Russian Witch Hunt.In many ways this is the greatest economy in the HISTORY of America and the best time EVER to look for a job!Big Supreme Court ruling for Baker just out!The Philadelphia Eagles Football Team was invited to the White House. Unfortunately, only a small number of players decided to come, and we canceled the event. Staying in the Locker Room for the playing of our National Anthem is as disrespectful to our country as kneeling. Sorry!SIGNIFICANT TWEETS AND NEWS:Supreme Court rules 7-2 in favor of Colorado baker who refused to bake a wedding cake for a gay couple on religious grounds. SCOTUS finds that the Colorado Civil Rights Commission did not consider this case with religious neutrality and violated the Free Exercise Clause.Stand for the Anthem or don’t come. I love this President.Watch Bernie Sanders Run From Alex Jones At LAX Airport29 Years ago Today. This is Communism. Never Forget.The media was all about an outgoing Obama pardoning Incoming Hillary. Then they were cool with Hillary pardoning herself. But now, because it’s DJT, now it’s a “constitutional crisis.” Sorry ass complicit jerk-offs.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:worst boycott ever #MAGAJust saw this on another sub. Pretty accurate tbhThis is America.BREAKING: In a narrow 2,623-487 county decision, Trump wins the US electionBREAKING: In narrow 77-0 decision, Oklahoma goes entirely Republican.Tuesday, June 5th:TODAY'S ACTION:President Trump Participates in the Celebration of AmericaHerschel Walker at the White House Sports and Fitness DayNatalie Gulbis at the White House Sports and Fitness DayPresident Trump Participates in the Signing Ceremony for S. 292🔥🔥TRUMP TWEETS🔥🔥:What is taking so long with the Inspector General’s Report on Crooked Hillary and Slippery James Comey. Numerous delays. Hope Report is not being changed and made weaker! There are so many horrible things to tell, the public has the right to know. Transparency!The U.S. has an increased economic value of more than 7 Trillion Dollars since the Election. May be the best economy in the history of our country. Record Jobs numbers. Nice!We will proudly be playing the National Anthem and other wonderful music celebrating our Country today at 3 P.M., The White House, with the United States Marine Band and the United States Army Chorus. Honoring America! NFL, no escaping to Locker Rooms!We have had many Championship teams recently at the White House including the Chicago Cubs, Houston Astros, Pittsburgh Penguins, New England Patriots, Alabama and Clemson National Champions, and many others. National Anthem & more great music today at 3:00 P.M.The Russian Witch Hunt Hoax continues, all because Jeff Sessions didn’t tell me he was going to recuse himself...I would have quickly picked someone else. So much time and money wasted, so many lives ruined...and Sessions knew better than most that there was No Collusion!Meeting in Singapore with North Korea will hopefully be the start of something big...we will soon [email protected] and Champion @MartinTruex_Jr were recently at the White House. It was a great day for a great sport!Separating families at the Border is the fault of bad legislation passed by the Democrats. Border Security laws should be changed but the Dems can’t get their act together! Started the Wall.In High Tax, High Crime California, be sure to get out and vote for Republican John Cox for Governor. He will make a BIG difference!Get the vote out in California today for Rep. Kevin McCarthy and all of the great GOP candidates for Congress. Keep our country out of the hands of High Tax, High Crime Nancy Pelosi.Vote for Congressman Devin Nunes, a true American Patriot the likes of which we rarely see in our modern day world....he truly loves our country and deserves everyone’s support!Senator @RogerWicker of Mississippi has done everything necessary to Make America Great Again! Get out and vote for Roger, he has my total support!Terrific new book out by the wonderful Harris Faulkner, “9 Rules of Engagement.” Harris shares lessons from a military family. Enjoy!The HISTORIC Rescissions Package we’ve proposed would cut $15,000,000,000 in Wasteful Spending! We are getting our government back on track.Imagine how much wasteful spending we’d save if we didn’t have Chuck and Nancy standing in our way! For years, Democrats in Congress have depleted our military and busted our budgets on needless spending, and to what end? No more.Wow, Strzok-Page, the incompetent & corrupt FBI lovers, have texts referring to a counter-intelligence operation into the Trump Campaign dating way back to December, 2015. SPYGATE is in full force! Is the Mainstream Media interested yet? Big stuff!(Retweeting Robby Starbuck) Fox News has been #1 for 197 months straight. In the latest ratings disaster for CNN they lost another 25% of their viewers. Fox has 10 of the top 15 shows and even hold the #1 spot in the younger key demo. The public is loudly rejecting @CNN.(Retweeting Eric Trump) #MakeAmericaGreatAgain 🇺🇸🇺🇸🇺🇸(Retweeting Brad Parscale) Since the #FakeNews is full of distortions, underreporting, and lies, we launched a platform tonight presenting a comprehensive record of @realDonaldTrump’s administration. The truth will be told about a remarkable 500-day record of accomplishments!Great interview by @LouDobbs with Chris Farrell of Judicial Watch concerning the governments counter-intelligence operation into the Trump Campaign. SPYGATE at the highest level. Who would believe? 10,534 replies 12,776 retweets 50,227 likesChris Farrell, Judicial Watch. “They were running an operation to undermine a candidate for President of the U.S. These are all violations of law. This is intelligence tradecraft to steer an election. There’s nothing more grave when it comes to abuse of our intelligence system... ... ...This is a level of criminality beyond the pale. This is such a grave abuse of power and authority, it’s like nothing else we’ve seen in our history. This makes the Nixon Watergate burglary look like keystone cop stuff....The greatest Witch Hunt in political history!Mitch McConnell announced he will cancel the Senate’s August Recess. Great, maybe the Democrats will finally get something done other than their acceptance of High Crime and High Taxes. We need Border Security!SIGNIFICANT TWEETS AND NEWS:For the first time in recorded American history the U.S. Department of Labor reports: Job openings exceed number of job seekers. (That.... Mr Obama is a fucking magic wand)TRUMP ON MIDTERMS: WE CANNOT BE COMPLACENT. GET OUT AND VOTE AL, IA, MS, MT, NJ, NM & SD!!Page/Strokz emails including the changing of the verbiage to exhonerate ClintonAndrew McCabe seeks immunity for testimony in congressional hearingTHIS IS YUUUUUUGE:U.S. Senate Majority Leader Mitch McConnell canceled the Senate's traditional August recess, citing Democrats' "historic obstruction" to pass legislation.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:The Blue Wave. Proof. It's Happening. The Democrats are "unstoppable".Different kids of diets😂 This past weekend #Antifa came out to play in the Pacific Northwest and did they ever get a surprise!GeniusDon't let the world forget KateTfw the OIG is taking so long with the report on Crooked Hillary and Slippery James ComeyWednesday, June 6th:TODAY'S ACTION:President Trump Participates in the Signing Ceremony for S. 2372 – VA Mission Act of 2018President Trump Signs VA Mission Act of 2018 into LawPresident Trump and Vice President Pence Attend the 2018 Hurricane Briefing at FEMA HQPresident Trump Delivers Remarks After the 2018 Hurricane Briefing at FEMA HQPresident Trump Hosts the White House IFTARPresident Donald J. Trump Announces Intent to Nominate and Appoint Personnel to Key Administration PostsPresident Donald J. Trump Announces Appointments for the Executive Office of the President🔥🔥TRUMP TWEETS🔥🔥:Great night for Republicans! Congratulations to John Cox on a really big number in California. He can win. Even Fake News CNN said the Trump impact was really big, much bigger than they ever thought possible. So much for the big Blue Wave, it may be a big Red Wave. Working hard!Gold Star father, Ceejay Metcalf, whose great son Michael was just honored at the White House, was fantastic this morning on @foxandfriends. He is a special man!The Fake News Media has been so unfair, and vicious, to my wife and our great First Lady, Melania. During her recovery from surgery they reported everything from near death, to facelift, to left the W.H. (and me) for N.Y. or Virginia, to abuse. All Fake, she is doing really well!...Four reporters spotted Melania in the White House last week walking merrily along to a meeting. They never reported the sighting because it would hurt the sick narrative that she was living in a different part of the world, was really ill, or whatever. Fake News is really bad!Many more Republican voters showed up yesterday than the Fake News thought possible. The political pundits just don’t get what is going on out there - or they do get it but refuse to report the facts! Remember, Dems are High Tax, High Crime, easy to beat!Congratulations to Dana Rohrabacher on his big California win. We are proud of you Dana!Today we mark another milestone: the 74th anniversary of #DDay, the Allied invasion of Normandy. On June 6, 1944, more than 70,000 brave young Americans charged out of landing craft, jumped out of airplanes, and stormed into hell...We must always protect those who protect us. Today, it was my great honor to sign the #VAMissionAct and to make Veterans Choice the permanent law of the land! http://45.wh.gov/dyWJNqThank you to everyone at @FEMA HQ for today’s briefing on preparations for the upcoming hurricane season. Disaster response and recovery is best achieved when it’s federally supported, state managed, and locally executed – this is the successful model we will continue to build.SIGNIFICANT TWEETS AND NEWS:Seventy-four years ago today American patriots fought and died by the thousands to stop real fascism, racial genocide, and oppression. Let's remember these brave Americans who gave it all so Soy Boys today can claim every patriotic American is a fascist and racist without a hint of irony. D-Day 44Steve Scalise back on the field today.BOMBSHELL REPORT: The Obama administration granted a license letting Iran access the United States financial system despite officials’ pledges that they would prohibit itPromisesKept.com President Donald J. Trump's AccomplishmentsHenry Winkler says he was among 118,000 voters 'left off' Los Angeles County rosters Fox NewsThe Most Ignored Bombshell of 2017: Samantha Power was caught using her security clearance as a UN ambassador to review private conversations by U.S. citizens 260 times in the 2016 election year... She said that someone else in the Obama White House did this, using her security clearance.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:This is AmericaThe most important comment I've ever made. If this message resonates with even one person then I will have made the world a better place.Commander of CheeseheadsMiss America crowned in advance! Judges cite her YUGE brains and charity work with mentally impaired media as key factors! Beautiful person!Thursday, June 7th:TODAY'S ACTION:They Said It Couldn't Be DonePresident Trumps Meets with the Prime Minister of JapanPresident Trump Hosts a Joint Press Conference with the Prime Minister of JapanPresident Trump Welcomes Prime Minister Shinzō Abe of Japan to the White House[]()🔥🔥TRUMP TWEETS🔥🔥:Isn’t it Ironic? Getting ready to go to the G-7 in Canada to fight for our country on Trade (we have the worst trade deals ever made), then off to Singapore to meet with North Korea & the Nuclear Problem...But back home we still have the 13 Angry Democrats pushing the Witch Hunt!Good luck to Alice Johnson. Have a wonderful life!Alan Dershowitz, Harvard Law Professor: “It all proves that we never needed a Special Counsel....All of this could have been done by the Justice Dept. Don’t need a multi-million dollar group of people with a target on someone’s back. Not the way Justice should operate.” So true!When and where will all of the many conflicts of interest be listed by the 13 Angry Democrats (plus) working on the Witch Hunt Hoax. There has never been a group of people on a case so biased or conflicted. It is all a Democrat Excuse for LOSING the Election. Where is the server?How could Jeff Flake, who is setting record low polling numbers in Arizona and was therefore humiliatingly forced out of his own Senate seat without even a fight (and who doesn’t have a clue), think about running for office, even a lower one, again? Let’s face it, he’s a Flake!Looking forward to seeing my friend Prime Minister @AbeShinzo of Japan at noon. Will be discussing North Korea and Trade.Our Justice Department must not let Awan & Debbie Wasserman Schultz off the hook. The Democrat I.T. scandal is a key to much of the corruption we see today. They want to make a “plea deal” to hide what is on their Server. Where is Server? Really bad!When will people start saying, “thank you, Mr. President, for firing James Comey?”The Obama Administration is now accused of trying to give Iran secret access to the financial system of the United States. This is totally illegal. Perhaps we could get the 13 Angry Democrats to divert some of their energy to this “matter” (as Comey would call it). Investigate!“Total jobless claims running at lowest level in 44 years”“$3 billion payoff: 101 utilities cut rates, credit GOP tax cuts”MAKING AMERICA GREAT AGAIN!It’s my great honor to welcome Prime Minister @AbeShinzo back to the @WhiteHouse!🇺🇸🇯🇵Today, I am greatly honored to welcome my good friend, PM Abe of Japan to the @WhiteHouse. Over the past 16 months the Prime Minister and I have worked closely together to address common challenges, of which there are many...PM Abe and I are also working to improve the trading relationship between the U.S. and Japan, something we have to do. The U.S. seeks a bilateral deal with Japan that is based on the principle of fairness and reciprocity. We’re working hard to reduce our trade imbalance...Great day of meetings with Prime Minister @AbeShinzo of Japan!Please tell Prime Minister Trudeau and President Macron that they are charging the U.S. massive tariffs and create non-monetary barriers. The EU trade surplus with the U.S. is $151 Billion, and Canada keeps our farmers and others out. Look forward to seeing them tomorrow.Prime Minister Trudeau is being so indignant, bringing up the relationship that the U.S. and Canada had over the many years and all sorts of other things...but he doesn’t bring up the fact that they charge us up to 300% on dairy — hurting our Farmers, killing our Agriculture!Why isn’t the European Union and Canada informing the public that for years they have used massive Trade Tariffs and non-monetary Trade Barriers against the U.S. Totally unfair to our farmers, workers & companies. Take down your tariffs & barriers or we will more than match you!SIGNIFICANT TWEETS AND NEWS:OUTRAGEOUS! New IG Report - Social Security Benefits paid to DACA! Illegals are receiving OUR Social Security Benefits!The Kent State 2A girl is a god-tier shitposter.MSNBC Calls Daughter Of Pardoned Alice Johnson — She Can’t Stop Thanking TrumpTime Magazine honors Trump again!!! Beautiful cover. The left can’t meme.LOL! Sean Hannity is trending on Twitter because he jokingly told "witnesses" to smash their phones with hammers before handing them over to Mueller. Stupid Liberals are saying he is tampering with evidence. They probably dont know thats what Hillary actually did.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:This is AmericaGrandfather was born a slave, mother was born a refugee, I was born freeThere are only 2 genders, and if you disagree then you're an Islamophobe. Leftist SJWs BTFO!Mirror, Mirror on THE WALL, who's the WOKEST of us ALL??Friday, June 8th:TODAY'S ACTION:President Donald J. Trump Proclaims June 14, 2018 as Flag Day and the Week Starting June 10, 2018 as National Flag WeekPresident Trump Delivers a Statement Upon DeparturePresident Trump Participates in an Expanded Bilateral Meeting with the Prime Minister of CanadaPresident Trump Participates in a Bilateral Meeting with the President of the French Republic🔥🔥TRUMP TWEETS🔥🔥:Obama, Schumer and Pelosi did NOTHING about North Korea, and now weak on Crime, High Tax Schumer is telling me what to do at the Summit the Dems could never set up. Schumer failed with North Korea and Iran, we don’t need his advice!Canada charges the U.S. a 270% tariff on Dairy Products! They didn’t tell you that, did they? Not fair to our farmers!Looking forward to straightening out unfair Trade Deals with the G-7 countries. If it doesn’t happen, we come out even better!Congratulations to the Washington Capitals on their GREAT play and winning the Stanley Cup Championship. Alex Ovechkin, the team captain, was spectacular - a true Superstar! D.C. is popping, in many ways. What a time!I am heading for Canada and the G-7 for talks that will mostly center on the long time unfair trade practiced against the United States. From there I go to Singapore and talks with North Korea on Denuclearization. Won’t be talking about the Russian Witch Hunt Hoax for a while!My thoughts and prayers are with the families of our serviceman who was killed and his fellow servicemen who were wounded in Somalia. They are truly all HEROES.(Retweeting G7 Canada) Day 1 of #G7Charlevoix in 60 seconds.SIGNIFICANT TWEETS AND NEWS:President Trump confirms intent to sign states' rights cannabis bill that was introduced in Congress yesterdayPewdiepie reuploads video exposing CNN and Hillary Clinton after it got copystriked and deleted!BAHAHAHAHAHA.............BAHAJSJSKGLGOGICSteam refuses to bend the knee to SJWs, choosing to stand with community - All content that is legal will be allowed.BREAKING: Trump tells kneeling NFL players to recommend people to pardon, since that's what they're supposedly protesting. Their reason to kneel just died. LOL🐸 TOP SPICE OF THE DAY 🐸:When you're surrounded by globalistsPresstitutesHookers for Hillary, I should have known...ARCHIVE: "Sleeping with your source- especially a vindictive congressman?" - Ali Watkins, 2013Saturday, June 10th:TODAY'S ACTION:President Trump delivers a statementSIGNIFICANT TWEETS AND NEWS:Ali Watkins not getting the probe she had hoped for; Feds have seized her email and phone records for investigation on James Wolfe!HOLY SHIT Last night Bill Maher said what every lefitist truly thinks but might not say out loud: That he HOPES FOR A RECESSION to hurt President Trump. They'd rather see our country fail if it means Trump won't succeed. This is peak Trump derangement, folks. SAD!James Wolfe Leak Investigation: Journalists Insist on a Double Standard - Andrew McCarthyNew italian PM Conte on Facebook: Historic alliance, new friendship 🤝 - Can't get tired of all this winning, MAGA and MIGA!!! 🍝🍔BREAKING: Seth Rich's Brother's Attorneys Subpoena Twitter to Turn Over All Direct Messages from: Wikileaks, Julian Assange, KimDotCom, Cassandra Fairbanks, Gateway Pundit, etc🐸 TOP SPICE OF THE DAY 🐸:The God Emperor and his court JesterUSA and Canada 🇺🇲🇨🇦Not a drill: European Union banning memes (seriously).Dressed up for me best friend Melania.So Much Winning, STILL NOT TIRED OF IT!!As always, some tunes to get you jamming through this long list of winning;Ghost Town4th DimensionNo MistakesWatchWhat Would Meek do?MAGA ON PATRIOTS!Submitted June 09, 2018 at 11:48AM by Ivaginaryfriend https://www.reddit.com/The\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_Donald/comments/8ptnk6/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /The_DonaldSubmitted June 09, 2018 at 12:48PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pu2ln/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pun4d/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 06:13PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pwc8s/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 07:13PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pwpq2/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 08:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pxdfj/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 10:18PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pxu3a/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 11:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pydsj/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 12:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pynsafternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 02:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pz72afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 03:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pzfe1/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 06:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q02kv/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 08:43AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q0jrp/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 09:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q0s8t/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 10:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q1bf2/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 12:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q1y1t/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q2m9o/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 05:28PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q41fu/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 06:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q4hwafternoon\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 08:23PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q57mj/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 09:28PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q5lxs/afternoon\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 11:48PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q6hj6/afternoon\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 12:18AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q6o1m/afternoon\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 01:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q71kt/afternoon\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 02:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q7hym/afternoon\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 03:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q7sgi/afternoon\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 06:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q8lkv/afternoon\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 08:23AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q93tt/afternoon\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 09:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q9iv4/afternoon\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 10:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qa4xafternoon\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 12:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qavpx/afternoon\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qbjwj/afternoon\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\_your\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 06:38PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qdrii/afternoon\\\\\\\\\\\\_magathread\\\\\\\\\\\\_your\\\\\\\\\\\\_weekly\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 08:23PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qehmo/afternoon\\\\\\\\\\\_magathread\\\\\\\\\\\_your\\\\\\\\\\\_weekly\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 09:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qf511/afternoon\\\\\\\\\\_magathread\\\\\\\\\\_your\\\\\\\\\\_weekly\\\\\\\\\\_presidential/?utm\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 11:18PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qfobv/afternoon\\\\\\\\\_magathread\\\\\\\\\_your\\\\\\\\\_weekly\\\\\\\\\_presidential/?utm\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 01:38AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qghk4/afternoon\\\\\\\\_magathread\\\\\\\\_your\\\\\\\\_weekly\\\\\\\\_presidential/?utm\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 02:38AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qgspl/afternoon\\\\\\\_magathread\\\\\\\_your\\\\\\\_weekly\\\\\\\_presidential/?utm\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 07:03AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qi1pi/afternoon\\\\\\_magathread\\\\\\_your\\\\\\_weekly\\\\\\_presidential/?utm\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 08:13AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qifwi/afternoon\\\\\_magathread\\\\\_your\\\\\_weekly\\\\\_presidential/?utm\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 09:33AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qiyie/afternoon\\\\_magathread\\\\_your\\\\_weekly\\\\_presidential/?utm\\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 10:43AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qjgyv/afternoon\\\_magathread\\\_your\\\_weekly\\\_presidential/?utm\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 12:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qkdu3/afternoon\\_magathread\\_your\\_weekly\\_presidential/?utm\\_source=iftttvia /MagaFirstNews
Submitted June 12, 2018 at 12:53PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qkjs6/afternoon\_magathread\_your\_weekly\_presidential/?utm\_source=ifttt
via /MagaFirstNews
submitted by peterboykin to MagaFirstNews [link] [comments]


2018.06.12 18:53 peterboykin Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!

Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!
Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!HAPPPPPPY SATURDAY, PATRIOTS!This is your girl u/IvaginaryFriend back at it again with a weeks worth of spice for you lovely Deplorables! (◠‿◠✿)Before we officially get this recap started, if you happened to miss any past recaps you can catch them here!Also, don't forget about our Header contest coming up on Monday, June 11th!!! The winning submission will be proudly presented at the top of the DOM for the next few months!!!Now, let's get on with the show!Sunday, June 3rd:🔥🔥TRUMP TWEETS🔥🔥:Jesse Watters “The only thing Trump obstructed was Hillary getting to the White House.” So true!As only one of two people left who could become President, why wouldn’t the FBI or Department of “Justice” have told me that they were secretly investigating Paul Manafort (on charges that were 10 years old and had been previously dropped) during my campaign? Should have told me!....Paul Manafort came into the campaign very late and was with us for a short period of time (he represented Ronald Reagan, Bob Dole & many others over the years), but we should have been told that Comey and the boys were doing a number on him, and he wouldn’t have been hired!Mark Penn “Why are there people from the Clinton Foundation on the Mueller Staff? Why is there an Independent Counsel? To go after people and their families for unrelated offenses...Constitution was set up to prevent this...Stormtrooper tactics almost.” A disgrace!SIGNIFICANT TWEETS AND NEWS:WINNING! U.S. Beats Singapore & Hong Kong To Become The World's Most Competitive Economy Again - #MAGA!Roseanne Barr is off TV but Samantha Bee is still on -- just another example of the media’s double standardThis timeline is unexpected. In 2018, I have already skipped a Star Wars movie in the theatres and paid money for a Kanye West Album.THE MADMAN-Probably the best quote in human history to date🐸 TOP SPICE OF THE DAY 🐸:"oh they're so good, oh they're so sweet."Today is Trump's 500th day as POTUS so here is a commemorative $500 bill.This triggers leftists.FITTON: My first official meme for the TD"Cuz we hate him"Monday, June 4th:TODAY'S ACTION:Vice President Pence Delivers Remarks at a Reception Promoting a Hemisphere of FreedomPresident Donald J. Trump Announces Intent to Nominate Personnel to a Key Administration PostPresidential Memorandum for the Secretary of StatePresidential Memorandum for the Secretary of StateEight Nominations Sent to the Senate Today🔥🔥TRUMP TWEETS🔥🔥:This is my 500th. Day in Office and we have accomplished a lot - many believe more than any President in his first 500 days. Massive Tax & Regulation Cuts, Military & Vets, Lower Crime & Illegal Immigration, Stronger Borders, Judgeships, Best Economy & Jobs EVER, and much more... ....We had Repeal & Replace done (and the saving to our country of one trillion dollars) except for one person, but it is getting done anyway. Individual Mandate is gone and great, less expensive plans will be announced this month. Drug prices coming down & Right to Try!“This is the best time EVER to look for a job.” James Freeman of WSJ.As has been stated by numerous legal scholars, I have the absolute right to PARDON myself, but why would I do that when I have done nothing wrong? In the meantime, the never ending Witch Hunt, led by 13 very Angry and Conflicted Democrats (& others) continues into the mid-terms!China already charges a tax of 16% on soybeans. Canada has all sorts of trade barriers on our Agricultural products. Not acceptable!The U.S. has made such bad trade deals over so many years that we can only WIN!Farmers have not been doing well for 15 years. Mexico, Canada, China and others have treated them unfairly. By the time I finish trade talks, that will change. Big trade barriers against U.S. farmers, and other businesses, will finally be broken. Massive trade deficits no longer!The appointment of the Special Counsel is totally UNCONSTITUTIONAL! Despite that, we play the game because I, unlike the Democrats, have done nothing wrong!#500Days of American Greatness: http://45.wh.gov/gNWs8uThe Fake News Media is desperate to distract from the economy and record setting economic numbers and so they keep talking about the phony Russian Witch Hunt.In many ways this is the greatest economy in the HISTORY of America and the best time EVER to look for a job!Big Supreme Court ruling for Baker just out!The Philadelphia Eagles Football Team was invited to the White House. Unfortunately, only a small number of players decided to come, and we canceled the event. Staying in the Locker Room for the playing of our National Anthem is as disrespectful to our country as kneeling. Sorry!SIGNIFICANT TWEETS AND NEWS:Supreme Court rules 7-2 in favor of Colorado baker who refused to bake a wedding cake for a gay couple on religious grounds. SCOTUS finds that the Colorado Civil Rights Commission did not consider this case with religious neutrality and violated the Free Exercise Clause.Stand for the Anthem or don’t come. I love this President.Watch Bernie Sanders Run From Alex Jones At LAX Airport29 Years ago Today. This is Communism. Never Forget.The media was all about an outgoing Obama pardoning Incoming Hillary. Then they were cool with Hillary pardoning herself. But now, because it’s DJT, now it’s a “constitutional crisis.” Sorry ass complicit jerk-offs.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:worst boycott ever #MAGAJust saw this on another sub. Pretty accurate tbhThis is America.BREAKING: In a narrow 2,623-487 county decision, Trump wins the US electionBREAKING: In narrow 77-0 decision, Oklahoma goes entirely Republican.Tuesday, June 5th:TODAY'S ACTION:President Trump Participates in the Celebration of AmericaHerschel Walker at the White House Sports and Fitness DayNatalie Gulbis at the White House Sports and Fitness DayPresident Trump Participates in the Signing Ceremony for S. 292🔥🔥TRUMP TWEETS🔥🔥:What is taking so long with the Inspector General’s Report on Crooked Hillary and Slippery James Comey. Numerous delays. Hope Report is not being changed and made weaker! There are so many horrible things to tell, the public has the right to know. Transparency!The U.S. has an increased economic value of more than 7 Trillion Dollars since the Election. May be the best economy in the history of our country. Record Jobs numbers. Nice!We will proudly be playing the National Anthem and other wonderful music celebrating our Country today at 3 P.M., The White House, with the United States Marine Band and the United States Army Chorus. Honoring America! NFL, no escaping to Locker Rooms!We have had many Championship teams recently at the White House including the Chicago Cubs, Houston Astros, Pittsburgh Penguins, New England Patriots, Alabama and Clemson National Champions, and many others. National Anthem & more great music today at 3:00 P.M.The Russian Witch Hunt Hoax continues, all because Jeff Sessions didn’t tell me he was going to recuse himself...I would have quickly picked someone else. So much time and money wasted, so many lives ruined...and Sessions knew better than most that there was No Collusion!Meeting in Singapore with North Korea will hopefully be the start of something big...we will soon [email protected] and Champion @MartinTruex_Jr were recently at the White House. It was a great day for a great sport!Separating families at the Border is the fault of bad legislation passed by the Democrats. Border Security laws should be changed but the Dems can’t get their act together! Started the Wall.In High Tax, High Crime California, be sure to get out and vote for Republican John Cox for Governor. He will make a BIG difference!Get the vote out in California today for Rep. Kevin McCarthy and all of the great GOP candidates for Congress. Keep our country out of the hands of High Tax, High Crime Nancy Pelosi.Vote for Congressman Devin Nunes, a true American Patriot the likes of which we rarely see in our modern day world....he truly loves our country and deserves everyone’s support!Senator @RogerWicker of Mississippi has done everything necessary to Make America Great Again! Get out and vote for Roger, he has my total support!Terrific new book out by the wonderful Harris Faulkner, “9 Rules of Engagement.” Harris shares lessons from a military family. Enjoy!The HISTORIC Rescissions Package we’ve proposed would cut $15,000,000,000 in Wasteful Spending! We are getting our government back on track.Imagine how much wasteful spending we’d save if we didn’t have Chuck and Nancy standing in our way! For years, Democrats in Congress have depleted our military and busted our budgets on needless spending, and to what end? No more.Wow, Strzok-Page, the incompetent & corrupt FBI lovers, have texts referring to a counter-intelligence operation into the Trump Campaign dating way back to December, 2015. SPYGATE is in full force! Is the Mainstream Media interested yet? Big stuff!(Retweeting Robby Starbuck) Fox News has been #1 for 197 months straight. In the latest ratings disaster for CNN they lost another 25% of their viewers. Fox has 10 of the top 15 shows and even hold the #1 spot in the younger key demo. The public is loudly rejecting @CNN.(Retweeting Eric Trump) #MakeAmericaGreatAgain 🇺🇸🇺🇸🇺🇸(Retweeting Brad Parscale) Since the #FakeNews is full of distortions, underreporting, and lies, we launched a platform tonight presenting a comprehensive record of @realDonaldTrump’s administration. The truth will be told about a remarkable 500-day record of accomplishments!Great interview by @LouDobbs with Chris Farrell of Judicial Watch concerning the governments counter-intelligence operation into the Trump Campaign. SPYGATE at the highest level. Who would believe? 10,534 replies 12,776 retweets 50,227 likesChris Farrell, Judicial Watch. “They were running an operation to undermine a candidate for President of the U.S. These are all violations of law. This is intelligence tradecraft to steer an election. There’s nothing more grave when it comes to abuse of our intelligence system... ... ...This is a level of criminality beyond the pale. This is such a grave abuse of power and authority, it’s like nothing else we’ve seen in our history. This makes the Nixon Watergate burglary look like keystone cop stuff....The greatest Witch Hunt in political history!Mitch McConnell announced he will cancel the Senate’s August Recess. Great, maybe the Democrats will finally get something done other than their acceptance of High Crime and High Taxes. We need Border Security!SIGNIFICANT TWEETS AND NEWS:For the first time in recorded American history the U.S. Department of Labor reports: Job openings exceed number of job seekers. (That.... Mr Obama is a fucking magic wand)TRUMP ON MIDTERMS: WE CANNOT BE COMPLACENT. GET OUT AND VOTE AL, IA, MS, MT, NJ, NM & SD!!Page/Strokz emails including the changing of the verbiage to exhonerate ClintonAndrew McCabe seeks immunity for testimony in congressional hearingTHIS IS YUUUUUUGE:U.S. Senate Majority Leader Mitch McConnell canceled the Senate's traditional August recess, citing Democrats' "historic obstruction" to pass legislation.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:The Blue Wave. Proof. It's Happening. The Democrats are "unstoppable".Different kids of diets😂 This past weekend #Antifa came out to play in the Pacific Northwest and did they ever get a surprise!GeniusDon't let the world forget KateTfw the OIG is taking so long with the report on Crooked Hillary and Slippery James ComeyWednesday, June 6th:TODAY'S ACTION:President Trump Participates in the Signing Ceremony for S. 2372 – VA Mission Act of 2018President Trump Signs VA Mission Act of 2018 into LawPresident Trump and Vice President Pence Attend the 2018 Hurricane Briefing at FEMA HQPresident Trump Delivers Remarks After the 2018 Hurricane Briefing at FEMA HQPresident Trump Hosts the White House IFTARPresident Donald J. Trump Announces Intent to Nominate and Appoint Personnel to Key Administration PostsPresident Donald J. Trump Announces Appointments for the Executive Office of the President🔥🔥TRUMP TWEETS🔥🔥:Great night for Republicans! Congratulations to John Cox on a really big number in California. He can win. Even Fake News CNN said the Trump impact was really big, much bigger than they ever thought possible. So much for the big Blue Wave, it may be a big Red Wave. Working hard!Gold Star father, Ceejay Metcalf, whose great son Michael was just honored at the White House, was fantastic this morning on @foxandfriends. He is a special man!The Fake News Media has been so unfair, and vicious, to my wife and our great First Lady, Melania. During her recovery from surgery they reported everything from near death, to facelift, to left the W.H. (and me) for N.Y. or Virginia, to abuse. All Fake, she is doing really well!...Four reporters spotted Melania in the White House last week walking merrily along to a meeting. They never reported the sighting because it would hurt the sick narrative that she was living in a different part of the world, was really ill, or whatever. Fake News is really bad!Many more Republican voters showed up yesterday than the Fake News thought possible. The political pundits just don’t get what is going on out there - or they do get it but refuse to report the facts! Remember, Dems are High Tax, High Crime, easy to beat!Congratulations to Dana Rohrabacher on his big California win. We are proud of you Dana!Today we mark another milestone: the 74th anniversary of #DDay, the Allied invasion of Normandy. On June 6, 1944, more than 70,000 brave young Americans charged out of landing craft, jumped out of airplanes, and stormed into hell...We must always protect those who protect us. Today, it was my great honor to sign the #VAMissionAct and to make Veterans Choice the permanent law of the land! http://45.wh.gov/dyWJNqThank you to everyone at @FEMA HQ for today’s briefing on preparations for the upcoming hurricane season. Disaster response and recovery is best achieved when it’s federally supported, state managed, and locally executed – this is the successful model we will continue to build.SIGNIFICANT TWEETS AND NEWS:Seventy-four years ago today American patriots fought and died by the thousands to stop real fascism, racial genocide, and oppression. Let's remember these brave Americans who gave it all so Soy Boys today can claim every patriotic American is a fascist and racist without a hint of irony. D-Day 44Steve Scalise back on the field today.BOMBSHELL REPORT: The Obama administration granted a license letting Iran access the United States financial system despite officials’ pledges that they would prohibit itPromisesKept.com President Donald J. Trump's AccomplishmentsHenry Winkler says he was among 118,000 voters 'left off' Los Angeles County rosters Fox NewsThe Most Ignored Bombshell of 2017: Samantha Power was caught using her security clearance as a UN ambassador to review private conversations by U.S. citizens 260 times in the 2016 election year... She said that someone else in the Obama White House did this, using her security clearance.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:This is AmericaThe most important comment I've ever made. If this message resonates with even one person then I will have made the world a better place.Commander of CheeseheadsMiss America crowned in advance! Judges cite her YUGE brains and charity work with mentally impaired media as key factors! Beautiful person!Thursday, June 7th:TODAY'S ACTION:They Said It Couldn't Be DonePresident Trumps Meets with the Prime Minister of JapanPresident Trump Hosts a Joint Press Conference with the Prime Minister of JapanPresident Trump Welcomes Prime Minister Shinzō Abe of Japan to the White House[]()🔥🔥TRUMP TWEETS🔥🔥:Isn’t it Ironic? Getting ready to go to the G-7 in Canada to fight for our country on Trade (we have the worst trade deals ever made), then off to Singapore to meet with North Korea & the Nuclear Problem...But back home we still have the 13 Angry Democrats pushing the Witch Hunt!Good luck to Alice Johnson. Have a wonderful life!Alan Dershowitz, Harvard Law Professor: “It all proves that we never needed a Special Counsel....All of this could have been done by the Justice Dept. Don’t need a multi-million dollar group of people with a target on someone’s back. Not the way Justice should operate.” So true!When and where will all of the many conflicts of interest be listed by the 13 Angry Democrats (plus) working on the Witch Hunt Hoax. There has never been a group of people on a case so biased or conflicted. It is all a Democrat Excuse for LOSING the Election. Where is the server?How could Jeff Flake, who is setting record low polling numbers in Arizona and was therefore humiliatingly forced out of his own Senate seat without even a fight (and who doesn’t have a clue), think about running for office, even a lower one, again? Let’s face it, he’s a Flake!Looking forward to seeing my friend Prime Minister @AbeShinzo of Japan at noon. Will be discussing North Korea and Trade.Our Justice Department must not let Awan & Debbie Wasserman Schultz off the hook. The Democrat I.T. scandal is a key to much of the corruption we see today. They want to make a “plea deal” to hide what is on their Server. Where is Server? Really bad!When will people start saying, “thank you, Mr. President, for firing James Comey?”The Obama Administration is now accused of trying to give Iran secret access to the financial system of the United States. This is totally illegal. Perhaps we could get the 13 Angry Democrats to divert some of their energy to this “matter” (as Comey would call it). Investigate!“Total jobless claims running at lowest level in 44 years”“$3 billion payoff: 101 utilities cut rates, credit GOP tax cuts”MAKING AMERICA GREAT AGAIN!It’s my great honor to welcome Prime Minister @AbeShinzo back to the @WhiteHouse!🇺🇸🇯🇵Today, I am greatly honored to welcome my good friend, PM Abe of Japan to the @WhiteHouse. Over the past 16 months the Prime Minister and I have worked closely together to address common challenges, of which there are many...PM Abe and I are also working to improve the trading relationship between the U.S. and Japan, something we have to do. The U.S. seeks a bilateral deal with Japan that is based on the principle of fairness and reciprocity. We’re working hard to reduce our trade imbalance...Great day of meetings with Prime Minister @AbeShinzo of Japan!Please tell Prime Minister Trudeau and President Macron that they are charging the U.S. massive tariffs and create non-monetary barriers. The EU trade surplus with the U.S. is $151 Billion, and Canada keeps our farmers and others out. Look forward to seeing them tomorrow.Prime Minister Trudeau is being so indignant, bringing up the relationship that the U.S. and Canada had over the many years and all sorts of other things...but he doesn’t bring up the fact that they charge us up to 300% on dairy — hurting our Farmers, killing our Agriculture!Why isn’t the European Union and Canada informing the public that for years they have used massive Trade Tariffs and non-monetary Trade Barriers against the U.S. Totally unfair to our farmers, workers & companies. Take down your tariffs & barriers or we will more than match you!SIGNIFICANT TWEETS AND NEWS:OUTRAGEOUS! New IG Report - Social Security Benefits paid to DACA! Illegals are receiving OUR Social Security Benefits!The Kent State 2A girl is a god-tier shitposter.MSNBC Calls Daughter Of Pardoned Alice Johnson — She Can’t Stop Thanking TrumpTime Magazine honors Trump again!!! Beautiful cover. The left can’t meme.LOL! Sean Hannity is trending on Twitter because he jokingly told "witnesses" to smash their phones with hammers before handing them over to Mueller. Stupid Liberals are saying he is tampering with evidence. They probably dont know thats what Hillary actually did.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:This is AmericaGrandfather was born a slave, mother was born a refugee, I was born freeThere are only 2 genders, and if you disagree then you're an Islamophobe. Leftist SJWs BTFO!Mirror, Mirror on THE WALL, who's the WOKEST of us ALL??Friday, June 8th:TODAY'S ACTION:President Donald J. Trump Proclaims June 14, 2018 as Flag Day and the Week Starting June 10, 2018 as National Flag WeekPresident Trump Delivers a Statement Upon DeparturePresident Trump Participates in an Expanded Bilateral Meeting with the Prime Minister of CanadaPresident Trump Participates in a Bilateral Meeting with the President of the French Republic🔥🔥TRUMP TWEETS🔥🔥:Obama, Schumer and Pelosi did NOTHING about North Korea, and now weak on Crime, High Tax Schumer is telling me what to do at the Summit the Dems could never set up. Schumer failed with North Korea and Iran, we don’t need his advice!Canada charges the U.S. a 270% tariff on Dairy Products! They didn’t tell you that, did they? Not fair to our farmers!Looking forward to straightening out unfair Trade Deals with the G-7 countries. If it doesn’t happen, we come out even better!Congratulations to the Washington Capitals on their GREAT play and winning the Stanley Cup Championship. Alex Ovechkin, the team captain, was spectacular - a true Superstar! D.C. is popping, in many ways. What a time!I am heading for Canada and the G-7 for talks that will mostly center on the long time unfair trade practiced against the United States. From there I go to Singapore and talks with North Korea on Denuclearization. Won’t be talking about the Russian Witch Hunt Hoax for a while!My thoughts and prayers are with the families of our serviceman who was killed and his fellow servicemen who were wounded in Somalia. They are truly all HEROES.(Retweeting G7 Canada) Day 1 of #G7Charlevoix in 60 seconds.SIGNIFICANT TWEETS AND NEWS:President Trump confirms intent to sign states' rights cannabis bill that was introduced in Congress yesterdayPewdiepie reuploads video exposing CNN and Hillary Clinton after it got copystriked and deleted!BAHAHAHAHAHA.............BAHAJSJSKGLGOGICSteam refuses to bend the knee to SJWs, choosing to stand with community - All content that is legal will be allowed.BREAKING: Trump tells kneeling NFL players to recommend people to pardon, since that's what they're supposedly protesting. Their reason to kneel just died. LOL🐸 TOP SPICE OF THE DAY 🐸:When you're surrounded by globalistsPresstitutesHookers for Hillary, I should have known...ARCHIVE: "Sleeping with your source- especially a vindictive congressman?" - Ali Watkins, 2013Saturday, June 10th:TODAY'S ACTION:President Trump delivers a statementSIGNIFICANT TWEETS AND NEWS:Ali Watkins not getting the probe she had hoped for; Feds have seized her email and phone records for investigation on James Wolfe!HOLY SHIT Last night Bill Maher said what every lefitist truly thinks but might not say out loud: That he HOPES FOR A RECESSION to hurt President Trump. They'd rather see our country fail if it means Trump won't succeed. This is peak Trump derangement, folks. SAD!James Wolfe Leak Investigation: Journalists Insist on a Double Standard - Andrew McCarthyNew italian PM Conte on Facebook: Historic alliance, new friendship 🤝 - Can't get tired of all this winning, MAGA and MIGA!!! 🍝🍔BREAKING: Seth Rich's Brother's Attorneys Subpoena Twitter to Turn Over All Direct Messages from: Wikileaks, Julian Assange, KimDotCom, Cassandra Fairbanks, Gateway Pundit, etc🐸 TOP SPICE OF THE DAY 🐸:The God Emperor and his court JesterUSA and Canada 🇺🇲🇨🇦Not a drill: European Union banning memes (seriously).Dressed up for me best friend Melania.So Much Winning, STILL NOT TIRED OF IT!!As always, some tunes to get you jamming through this long list of winning;Ghost Town4th DimensionNo MistakesWatchWhat Would Meek do?MAGA ON PATRIOTS!Submitted June 09, 2018 at 11:48AM by Ivaginaryfriend https://www.reddit.com/The\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_Donald/comments/8ptnk6/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /The_DonaldSubmitted June 09, 2018 at 12:48PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pu2ln/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pun4d/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 06:13PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pwc8s/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 07:13PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pwpq2/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 08:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pxdfj/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 10:18PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pxu3a/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 11:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pydsj/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 12:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pynsafternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 02:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pz72afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 03:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pzfe1/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 06:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q02kv/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 08:43AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q0jrp/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 09:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q0s8t/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 10:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q1bf2/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 12:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q1y1t/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q2m9o/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 05:28PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q41fu/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 06:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q4hwafternoon\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 08:23PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q57mj/afternoon\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 09:28PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q5lxs/afternoon\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 11:48PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q6hj6/afternoon\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 12:18AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q6o1m/afternoon\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 01:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q71kt/afternoon\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 02:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q7hym/afternoon\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 03:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q7sgi/afternoon\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 06:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q8lkv/afternoon\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 08:23AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q93tt/afternoon\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 09:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q9iv4/afternoon\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 10:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qa4xafternoon\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 12:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qavpx/afternoon\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\_your\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qbjwj/afternoon\\\\\\\\\\\\_magathread\\\\\\\\\\\\_your\\\\\\\\\\\\_weekly\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 06:38PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qdrii/afternoon\\\\\\\\\\\_magathread\\\\\\\\\\\_your\\\\\\\\\\\_weekly\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 08:23PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qehmo/afternoon\\\\\\\\\\_magathread\\\\\\\\\\_your\\\\\\\\\\_weekly\\\\\\\\\\_presidential/?utm\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 09:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qf511/afternoon\\\\\\\\\_magathread\\\\\\\\\_your\\\\\\\\\_weekly\\\\\\\\\_presidential/?utm\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 11:18PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qfobv/afternoon\\\\\\\\_magathread\\\\\\\\_your\\\\\\\\_weekly\\\\\\\\_presidential/?utm\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 01:38AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qghk4/afternoon\\\\\\\_magathread\\\\\\\_your\\\\\\\_weekly\\\\\\\_presidential/?utm\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 02:38AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qgspl/afternoon\\\\\\_magathread\\\\\\_your\\\\\\_weekly\\\\\\_presidential/?utm\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 07:03AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qi1pi/afternoon\\\\\_magathread\\\\\_your\\\\\_weekly\\\\\_presidential/?utm\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 08:13AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qifwi/afternoon\\\\_magathread\\\\_your\\\\_weekly\\\\_presidential/?utm\\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 09:33AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qiyie/afternoon\\\_magathread\\\_your\\\_weekly\\\_presidential/?utm\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 10:43AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qjgyv/afternoon\\_magathread\\_your\\_weekly\\_presidential/?utm\\_source=iftttvia /MagaFirstNews
Submitted June 12, 2018 at 12:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qkdu3/afternoon\_magathread\_your\_weekly\_presidential/?utm\_source=ifttt
via /MagaFirstNews
submitted by peterboykin to MagaFirstNews [link] [comments]


2018.06.12 18:33 peterboykin Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!

Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!
Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!HAPPPPPPY SATURDAY, PATRIOTS!This is your girl u/IvaginaryFriend back at it again with a weeks worth of spice for you lovely Deplorables! (◠‿◠✿)Before we officially get this recap started, if you happened to miss any past recaps you can catch them here!Also, don't forget about our Header contest coming up on Monday, June 11th!!! The winning submission will be proudly presented at the top of the DOM for the next few months!!!Now, let's get on with the show!Sunday, June 3rd:🔥🔥TRUMP TWEETS🔥🔥:Jesse Watters “The only thing Trump obstructed was Hillary getting to the White House.” So true!As only one of two people left who could become President, why wouldn’t the FBI or Department of “Justice” have told me that they were secretly investigating Paul Manafort (on charges that were 10 years old and had been previously dropped) during my campaign? Should have told me!....Paul Manafort came into the campaign very late and was with us for a short period of time (he represented Ronald Reagan, Bob Dole & many others over the years), but we should have been told that Comey and the boys were doing a number on him, and he wouldn’t have been hired!Mark Penn “Why are there people from the Clinton Foundation on the Mueller Staff? Why is there an Independent Counsel? To go after people and their families for unrelated offenses...Constitution was set up to prevent this...Stormtrooper tactics almost.” A disgrace!SIGNIFICANT TWEETS AND NEWS:WINNING! U.S. Beats Singapore & Hong Kong To Become The World's Most Competitive Economy Again - #MAGA!Roseanne Barr is off TV but Samantha Bee is still on -- just another example of the media’s double standardThis timeline is unexpected. In 2018, I have already skipped a Star Wars movie in the theatres and paid money for a Kanye West Album.THE MADMAN-Probably the best quote in human history to date🐸 TOP SPICE OF THE DAY 🐸:"oh they're so good, oh they're so sweet."Today is Trump's 500th day as POTUS so here is a commemorative $500 bill.This triggers leftists.FITTON: My first official meme for the TD"Cuz we hate him"Monday, June 4th:TODAY'S ACTION:Vice President Pence Delivers Remarks at a Reception Promoting a Hemisphere of FreedomPresident Donald J. Trump Announces Intent to Nominate Personnel to a Key Administration PostPresidential Memorandum for the Secretary of StatePresidential Memorandum for the Secretary of StateEight Nominations Sent to the Senate Today🔥🔥TRUMP TWEETS🔥🔥:This is my 500th. Day in Office and we have accomplished a lot - many believe more than any President in his first 500 days. Massive Tax & Regulation Cuts, Military & Vets, Lower Crime & Illegal Immigration, Stronger Borders, Judgeships, Best Economy & Jobs EVER, and much more... ....We had Repeal & Replace done (and the saving to our country of one trillion dollars) except for one person, but it is getting done anyway. Individual Mandate is gone and great, less expensive plans will be announced this month. Drug prices coming down & Right to Try!“This is the best time EVER to look for a job.” James Freeman of WSJ.As has been stated by numerous legal scholars, I have the absolute right to PARDON myself, but why would I do that when I have done nothing wrong? In the meantime, the never ending Witch Hunt, led by 13 very Angry and Conflicted Democrats (& others) continues into the mid-terms!China already charges a tax of 16% on soybeans. Canada has all sorts of trade barriers on our Agricultural products. Not acceptable!The U.S. has made such bad trade deals over so many years that we can only WIN!Farmers have not been doing well for 15 years. Mexico, Canada, China and others have treated them unfairly. By the time I finish trade talks, that will change. Big trade barriers against U.S. farmers, and other businesses, will finally be broken. Massive trade deficits no longer!The appointment of the Special Counsel is totally UNCONSTITUTIONAL! Despite that, we play the game because I, unlike the Democrats, have done nothing wrong!#500Days of American Greatness: http://45.wh.gov/gNWs8uThe Fake News Media is desperate to distract from the economy and record setting economic numbers and so they keep talking about the phony Russian Witch Hunt.In many ways this is the greatest economy in the HISTORY of America and the best time EVER to look for a job!Big Supreme Court ruling for Baker just out!The Philadelphia Eagles Football Team was invited to the White House. Unfortunately, only a small number of players decided to come, and we canceled the event. Staying in the Locker Room for the playing of our National Anthem is as disrespectful to our country as kneeling. Sorry!SIGNIFICANT TWEETS AND NEWS:Supreme Court rules 7-2 in favor of Colorado baker who refused to bake a wedding cake for a gay couple on religious grounds. SCOTUS finds that the Colorado Civil Rights Commission did not consider this case with religious neutrality and violated the Free Exercise Clause.Stand for the Anthem or don’t come. I love this President.Watch Bernie Sanders Run From Alex Jones At LAX Airport29 Years ago Today. This is Communism. Never Forget.The media was all about an outgoing Obama pardoning Incoming Hillary. Then they were cool with Hillary pardoning herself. But now, because it’s DJT, now it’s a “constitutional crisis.” Sorry ass complicit jerk-offs.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:worst boycott ever #MAGAJust saw this on another sub. Pretty accurate tbhThis is America.BREAKING: In a narrow 2,623-487 county decision, Trump wins the US electionBREAKING: In narrow 77-0 decision, Oklahoma goes entirely Republican.Tuesday, June 5th:TODAY'S ACTION:President Trump Participates in the Celebration of AmericaHerschel Walker at the White House Sports and Fitness DayNatalie Gulbis at the White House Sports and Fitness DayPresident Trump Participates in the Signing Ceremony for S. 292🔥🔥TRUMP TWEETS🔥🔥:What is taking so long with the Inspector General’s Report on Crooked Hillary and Slippery James Comey. Numerous delays. Hope Report is not being changed and made weaker! There are so many horrible things to tell, the public has the right to know. Transparency!The U.S. has an increased economic value of more than 7 Trillion Dollars since the Election. May be the best economy in the history of our country. Record Jobs numbers. Nice!We will proudly be playing the National Anthem and other wonderful music celebrating our Country today at 3 P.M., The White House, with the United States Marine Band and the United States Army Chorus. Honoring America! NFL, no escaping to Locker Rooms!We have had many Championship teams recently at the White House including the Chicago Cubs, Houston Astros, Pittsburgh Penguins, New England Patriots, Alabama and Clemson National Champions, and many others. National Anthem & more great music today at 3:00 P.M.The Russian Witch Hunt Hoax continues, all because Jeff Sessions didn’t tell me he was going to recuse himself...I would have quickly picked someone else. So much time and money wasted, so many lives ruined...and Sessions knew better than most that there was No Collusion!Meeting in Singapore with North Korea will hopefully be the start of something big...we will soon [email protected] and Champion @MartinTruex_Jr were recently at the White House. It was a great day for a great sport!Separating families at the Border is the fault of bad legislation passed by the Democrats. Border Security laws should be changed but the Dems can’t get their act together! Started the Wall.In High Tax, High Crime California, be sure to get out and vote for Republican John Cox for Governor. He will make a BIG difference!Get the vote out in California today for Rep. Kevin McCarthy and all of the great GOP candidates for Congress. Keep our country out of the hands of High Tax, High Crime Nancy Pelosi.Vote for Congressman Devin Nunes, a true American Patriot the likes of which we rarely see in our modern day world....he truly loves our country and deserves everyone’s support!Senator @RogerWicker of Mississippi has done everything necessary to Make America Great Again! Get out and vote for Roger, he has my total support!Terrific new book out by the wonderful Harris Faulkner, “9 Rules of Engagement.” Harris shares lessons from a military family. Enjoy!The HISTORIC Rescissions Package we’ve proposed would cut $15,000,000,000 in Wasteful Spending! We are getting our government back on track.Imagine how much wasteful spending we’d save if we didn’t have Chuck and Nancy standing in our way! For years, Democrats in Congress have depleted our military and busted our budgets on needless spending, and to what end? No more.Wow, Strzok-Page, the incompetent & corrupt FBI lovers, have texts referring to a counter-intelligence operation into the Trump Campaign dating way back to December, 2015. SPYGATE is in full force! Is the Mainstream Media interested yet? Big stuff!(Retweeting Robby Starbuck) Fox News has been #1 for 197 months straight. In the latest ratings disaster for CNN they lost another 25% of their viewers. Fox has 10 of the top 15 shows and even hold the #1 spot in the younger key demo. The public is loudly rejecting @CNN.(Retweeting Eric Trump) #MakeAmericaGreatAgain 🇺🇸🇺🇸🇺🇸(Retweeting Brad Parscale) Since the #FakeNews is full of distortions, underreporting, and lies, we launched a platform tonight presenting a comprehensive record of @realDonaldTrump’s administration. The truth will be told about a remarkable 500-day record of accomplishments!Great interview by @LouDobbs with Chris Farrell of Judicial Watch concerning the governments counter-intelligence operation into the Trump Campaign. SPYGATE at the highest level. Who would believe? 10,534 replies 12,776 retweets 50,227 likesChris Farrell, Judicial Watch. “They were running an operation to undermine a candidate for President of the U.S. These are all violations of law. This is intelligence tradecraft to steer an election. There’s nothing more grave when it comes to abuse of our intelligence system... ... ...This is a level of criminality beyond the pale. This is such a grave abuse of power and authority, it’s like nothing else we’ve seen in our history. This makes the Nixon Watergate burglary look like keystone cop stuff....The greatest Witch Hunt in political history!Mitch McConnell announced he will cancel the Senate’s August Recess. Great, maybe the Democrats will finally get something done other than their acceptance of High Crime and High Taxes. We need Border Security!SIGNIFICANT TWEETS AND NEWS:For the first time in recorded American history the U.S. Department of Labor reports: Job openings exceed number of job seekers. (That.... Mr Obama is a fucking magic wand)TRUMP ON MIDTERMS: WE CANNOT BE COMPLACENT. GET OUT AND VOTE AL, IA, MS, MT, NJ, NM & SD!!Page/Strokz emails including the changing of the verbiage to exhonerate ClintonAndrew McCabe seeks immunity for testimony in congressional hearingTHIS IS YUUUUUUGE:U.S. Senate Majority Leader Mitch McConnell canceled the Senate's traditional August recess, citing Democrats' "historic obstruction" to pass legislation.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:The Blue Wave. Proof. It's Happening. The Democrats are "unstoppable".Different kids of diets😂 This past weekend #Antifa came out to play in the Pacific Northwest and did they ever get a surprise!GeniusDon't let the world forget KateTfw the OIG is taking so long with the report on Crooked Hillary and Slippery James ComeyWednesday, June 6th:TODAY'S ACTION:President Trump Participates in the Signing Ceremony for S. 2372 – VA Mission Act of 2018President Trump Signs VA Mission Act of 2018 into LawPresident Trump and Vice President Pence Attend the 2018 Hurricane Briefing at FEMA HQPresident Trump Delivers Remarks After the 2018 Hurricane Briefing at FEMA HQPresident Trump Hosts the White House IFTARPresident Donald J. Trump Announces Intent to Nominate and Appoint Personnel to Key Administration PostsPresident Donald J. Trump Announces Appointments for the Executive Office of the President🔥🔥TRUMP TWEETS🔥🔥:Great night for Republicans! Congratulations to John Cox on a really big number in California. He can win. Even Fake News CNN said the Trump impact was really big, much bigger than they ever thought possible. So much for the big Blue Wave, it may be a big Red Wave. Working hard!Gold Star father, Ceejay Metcalf, whose great son Michael was just honored at the White House, was fantastic this morning on @foxandfriends. He is a special man!The Fake News Media has been so unfair, and vicious, to my wife and our great First Lady, Melania. During her recovery from surgery they reported everything from near death, to facelift, to left the W.H. (and me) for N.Y. or Virginia, to abuse. All Fake, she is doing really well!...Four reporters spotted Melania in the White House last week walking merrily along to a meeting. They never reported the sighting because it would hurt the sick narrative that she was living in a different part of the world, was really ill, or whatever. Fake News is really bad!Many more Republican voters showed up yesterday than the Fake News thought possible. The political pundits just don’t get what is going on out there - or they do get it but refuse to report the facts! Remember, Dems are High Tax, High Crime, easy to beat!Congratulations to Dana Rohrabacher on his big California win. We are proud of you Dana!Today we mark another milestone: the 74th anniversary of #DDay, the Allied invasion of Normandy. On June 6, 1944, more than 70,000 brave young Americans charged out of landing craft, jumped out of airplanes, and stormed into hell...We must always protect those who protect us. Today, it was my great honor to sign the #VAMissionAct and to make Veterans Choice the permanent law of the land! http://45.wh.gov/dyWJNqThank you to everyone at @FEMA HQ for today’s briefing on preparations for the upcoming hurricane season. Disaster response and recovery is best achieved when it’s federally supported, state managed, and locally executed – this is the successful model we will continue to build.SIGNIFICANT TWEETS AND NEWS:Seventy-four years ago today American patriots fought and died by the thousands to stop real fascism, racial genocide, and oppression. Let's remember these brave Americans who gave it all so Soy Boys today can claim every patriotic American is a fascist and racist without a hint of irony. D-Day 44Steve Scalise back on the field today.BOMBSHELL REPORT: The Obama administration granted a license letting Iran access the United States financial system despite officials’ pledges that they would prohibit itPromisesKept.com President Donald J. Trump's AccomplishmentsHenry Winkler says he was among 118,000 voters 'left off' Los Angeles County rosters Fox NewsThe Most Ignored Bombshell of 2017: Samantha Power was caught using her security clearance as a UN ambassador to review private conversations by U.S. citizens 260 times in the 2016 election year... She said that someone else in the Obama White House did this, using her security clearance.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:This is AmericaThe most important comment I've ever made. If this message resonates with even one person then I will have made the world a better place.Commander of CheeseheadsMiss America crowned in advance! Judges cite her YUGE brains and charity work with mentally impaired media as key factors! Beautiful person!Thursday, June 7th:TODAY'S ACTION:They Said It Couldn't Be DonePresident Trumps Meets with the Prime Minister of JapanPresident Trump Hosts a Joint Press Conference with the Prime Minister of JapanPresident Trump Welcomes Prime Minister Shinzō Abe of Japan to the White House[]()🔥🔥TRUMP TWEETS🔥🔥:Isn’t it Ironic? Getting ready to go to the G-7 in Canada to fight for our country on Trade (we have the worst trade deals ever made), then off to Singapore to meet with North Korea & the Nuclear Problem...But back home we still have the 13 Angry Democrats pushing the Witch Hunt!Good luck to Alice Johnson. Have a wonderful life!Alan Dershowitz, Harvard Law Professor: “It all proves that we never needed a Special Counsel....All of this could have been done by the Justice Dept. Don’t need a multi-million dollar group of people with a target on someone’s back. Not the way Justice should operate.” So true!When and where will all of the many conflicts of interest be listed by the 13 Angry Democrats (plus) working on the Witch Hunt Hoax. There has never been a group of people on a case so biased or conflicted. It is all a Democrat Excuse for LOSING the Election. Where is the server?How could Jeff Flake, who is setting record low polling numbers in Arizona and was therefore humiliatingly forced out of his own Senate seat without even a fight (and who doesn’t have a clue), think about running for office, even a lower one, again? Let’s face it, he’s a Flake!Looking forward to seeing my friend Prime Minister @AbeShinzo of Japan at noon. Will be discussing North Korea and Trade.Our Justice Department must not let Awan & Debbie Wasserman Schultz off the hook. The Democrat I.T. scandal is a key to much of the corruption we see today. They want to make a “plea deal” to hide what is on their Server. Where is Server? Really bad!When will people start saying, “thank you, Mr. President, for firing James Comey?”The Obama Administration is now accused of trying to give Iran secret access to the financial system of the United States. This is totally illegal. Perhaps we could get the 13 Angry Democrats to divert some of their energy to this “matter” (as Comey would call it). Investigate!“Total jobless claims running at lowest level in 44 years”“$3 billion payoff: 101 utilities cut rates, credit GOP tax cuts”MAKING AMERICA GREAT AGAIN!It’s my great honor to welcome Prime Minister @AbeShinzo back to the @WhiteHouse!🇺🇸🇯🇵Today, I am greatly honored to welcome my good friend, PM Abe of Japan to the @WhiteHouse. Over the past 16 months the Prime Minister and I have worked closely together to address common challenges, of which there are many...PM Abe and I are also working to improve the trading relationship between the U.S. and Japan, something we have to do. The U.S. seeks a bilateral deal with Japan that is based on the principle of fairness and reciprocity. We’re working hard to reduce our trade imbalance...Great day of meetings with Prime Minister @AbeShinzo of Japan!Please tell Prime Minister Trudeau and President Macron that they are charging the U.S. massive tariffs and create non-monetary barriers. The EU trade surplus with the U.S. is $151 Billion, and Canada keeps our farmers and others out. Look forward to seeing them tomorrow.Prime Minister Trudeau is being so indignant, bringing up the relationship that the U.S. and Canada had over the many years and all sorts of other things...but he doesn’t bring up the fact that they charge us up to 300% on dairy — hurting our Farmers, killing our Agriculture!Why isn’t the European Union and Canada informing the public that for years they have used massive Trade Tariffs and non-monetary Trade Barriers against the U.S. Totally unfair to our farmers, workers & companies. Take down your tariffs & barriers or we will more than match you!SIGNIFICANT TWEETS AND NEWS:OUTRAGEOUS! New IG Report - Social Security Benefits paid to DACA! Illegals are receiving OUR Social Security Benefits!The Kent State 2A girl is a god-tier shitposter.MSNBC Calls Daughter Of Pardoned Alice Johnson — She Can’t Stop Thanking TrumpTime Magazine honors Trump again!!! Beautiful cover. The left can’t meme.LOL! Sean Hannity is trending on Twitter because he jokingly told "witnesses" to smash their phones with hammers before handing them over to Mueller. Stupid Liberals are saying he is tampering with evidence. They probably dont know thats what Hillary actually did.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:This is AmericaGrandfather was born a slave, mother was born a refugee, I was born freeThere are only 2 genders, and if you disagree then you're an Islamophobe. Leftist SJWs BTFO!Mirror, Mirror on THE WALL, who's the WOKEST of us ALL??Friday, June 8th:TODAY'S ACTION:President Donald J. Trump Proclaims June 14, 2018 as Flag Day and the Week Starting June 10, 2018 as National Flag WeekPresident Trump Delivers a Statement Upon DeparturePresident Trump Participates in an Expanded Bilateral Meeting with the Prime Minister of CanadaPresident Trump Participates in a Bilateral Meeting with the President of the French Republic🔥🔥TRUMP TWEETS🔥🔥:Obama, Schumer and Pelosi did NOTHING about North Korea, and now weak on Crime, High Tax Schumer is telling me what to do at the Summit the Dems could never set up. Schumer failed with North Korea and Iran, we don’t need his advice!Canada charges the U.S. a 270% tariff on Dairy Products! They didn’t tell you that, did they? Not fair to our farmers!Looking forward to straightening out unfair Trade Deals with the G-7 countries. If it doesn’t happen, we come out even better!Congratulations to the Washington Capitals on their GREAT play and winning the Stanley Cup Championship. Alex Ovechkin, the team captain, was spectacular - a true Superstar! D.C. is popping, in many ways. What a time!I am heading for Canada and the G-7 for talks that will mostly center on the long time unfair trade practiced against the United States. From there I go to Singapore and talks with North Korea on Denuclearization. Won’t be talking about the Russian Witch Hunt Hoax for a while!My thoughts and prayers are with the families of our serviceman who was killed and his fellow servicemen who were wounded in Somalia. They are truly all HEROES.(Retweeting G7 Canada) Day 1 of #G7Charlevoix in 60 seconds.SIGNIFICANT TWEETS AND NEWS:President Trump confirms intent to sign states' rights cannabis bill that was introduced in Congress yesterdayPewdiepie reuploads video exposing CNN and Hillary Clinton after it got copystriked and deleted!BAHAHAHAHAHA.............BAHAJSJSKGLGOGICSteam refuses to bend the knee to SJWs, choosing to stand with community - All content that is legal will be allowed.BREAKING: Trump tells kneeling NFL players to recommend people to pardon, since that's what they're supposedly protesting. Their reason to kneel just died. LOL🐸 TOP SPICE OF THE DAY 🐸:When you're surrounded by globalistsPresstitutesHookers for Hillary, I should have known...ARCHIVE: "Sleeping with your source- especially a vindictive congressman?" - Ali Watkins, 2013Saturday, June 10th:TODAY'S ACTION:President Trump delivers a statementSIGNIFICANT TWEETS AND NEWS:Ali Watkins not getting the probe she had hoped for; Feds have seized her email and phone records for investigation on James Wolfe!HOLY SHIT Last night Bill Maher said what every lefitist truly thinks but might not say out loud: That he HOPES FOR A RECESSION to hurt President Trump. They'd rather see our country fail if it means Trump won't succeed. This is peak Trump derangement, folks. SAD!James Wolfe Leak Investigation: Journalists Insist on a Double Standard - Andrew McCarthyNew italian PM Conte on Facebook: Historic alliance, new friendship 🤝 - Can't get tired of all this winning, MAGA and MIGA!!! 🍝🍔BREAKING: Seth Rich's Brother's Attorneys Subpoena Twitter to Turn Over All Direct Messages from: Wikileaks, Julian Assange, KimDotCom, Cassandra Fairbanks, Gateway Pundit, etc🐸 TOP SPICE OF THE DAY 🐸:The God Emperor and his court JesterUSA and Canada 🇺🇲🇨🇦Not a drill: European Union banning memes (seriously).Dressed up for me best friend Melania.So Much Winning, STILL NOT TIRED OF IT!!As always, some tunes to get you jamming through this long list of winning;Ghost Town4th DimensionNo MistakesWatchWhat Would Meek do?MAGA ON PATRIOTS!Submitted June 09, 2018 at 11:48AM by Ivaginaryfriend https://www.reddit.com/The\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_Donald/comments/8ptnk6/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /The_DonaldSubmitted June 09, 2018 at 12:48PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pu2ln/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pun4d/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 06:13PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pwc8s/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 07:13PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pwpq2/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 08:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pxdfj/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 10:18PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pxu3a/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 11:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pydsj/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 12:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pynsafternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 02:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pz72afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 03:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pzfe1/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 06:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q02kv/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 08:43AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q0jrp/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 09:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q0s8t/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 10:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q1bf2/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 12:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q1y1t/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q2m9o/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 05:28PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q41fu/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 06:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q4hwafternoon\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 08:23PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q57mj/afternoon\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 09:28PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q5lxs/afternoon\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 11:48PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q6hj6/afternoon\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 12:18AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q6o1m/afternoon\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 01:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q71kt/afternoon\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 02:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q7hym/afternoon\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 03:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q7sgi/afternoon\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 06:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q8lkv/afternoon\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 08:23AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q93tt/afternoon\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 09:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q9iv4/afternoon\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 10:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qa4xafternoon\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\_your\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 12:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qavpx/afternoon\\\\\\\\\\\\_magathread\\\\\\\\\\\\_your\\\\\\\\\\\\_weekly\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qbjwj/afternoon\\\\\\\\\\\_magathread\\\\\\\\\\\_your\\\\\\\\\\\_weekly\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 06:38PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qdrii/afternoon\\\\\\\\\\_magathread\\\\\\\\\\_your\\\\\\\\\\_weekly\\\\\\\\\\_presidential/?utm\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 08:23PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qehmo/afternoon\\\\\\\\\_magathread\\\\\\\\\_your\\\\\\\\\_weekly\\\\\\\\\_presidential/?utm\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 09:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qf511/afternoon\\\\\\\\_magathread\\\\\\\\_your\\\\\\\\_weekly\\\\\\\\_presidential/?utm\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 11:18PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qfobv/afternoon\\\\\\\_magathread\\\\\\\_your\\\\\\\_weekly\\\\\\\_presidential/?utm\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 01:38AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qghk4/afternoon\\\\\\_magathread\\\\\\_your\\\\\\_weekly\\\\\\_presidential/?utm\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 02:38AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qgspl/afternoon\\\\\_magathread\\\\\_your\\\\\_weekly\\\\\_presidential/?utm\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 07:03AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qi1pi/afternoon\\\\_magathread\\\\_your\\\\_weekly\\\\_presidential/?utm\\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 08:13AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qifwi/afternoon\\\_magathread\\\_your\\\_weekly\\\_presidential/?utm\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 09:33AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qiyie/afternoon\\_magathread\\_your\\_weekly\\_presidential/?utm\\_source=iftttvia /MagaFirstNews
Submitted June 12, 2018 at 10:43AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qjgyv/afternoon\_magathread\_your\_weekly\_presidential/?utm\_source=ifttt
via /MagaFirstNews
submitted by peterboykin to MagaFirstNews [link] [comments]


2018.06.12 16:43 peterboykin Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!

Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!
Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!HAPPPPPPY SATURDAY, PATRIOTS!This is your girl u/IvaginaryFriend back at it again with a weeks worth of spice for you lovely Deplorables! (◠‿◠✿)Before we officially get this recap started, if you happened to miss any past recaps you can catch them here!Also, don't forget about our Header contest coming up on Monday, June 11th!!! The winning submission will be proudly presented at the top of the DOM for the next few months!!!Now, let's get on with the show!Sunday, June 3rd:🔥🔥TRUMP TWEETS🔥🔥:Jesse Watters “The only thing Trump obstructed was Hillary getting to the White House.” So true!As only one of two people left who could become President, why wouldn’t the FBI or Department of “Justice” have told me that they were secretly investigating Paul Manafort (on charges that were 10 years old and had been previously dropped) during my campaign? Should have told me!....Paul Manafort came into the campaign very late and was with us for a short period of time (he represented Ronald Reagan, Bob Dole & many others over the years), but we should have been told that Comey and the boys were doing a number on him, and he wouldn’t have been hired!Mark Penn “Why are there people from the Clinton Foundation on the Mueller Staff? Why is there an Independent Counsel? To go after people and their families for unrelated offenses...Constitution was set up to prevent this...Stormtrooper tactics almost.” A disgrace!SIGNIFICANT TWEETS AND NEWS:WINNING! U.S. Beats Singapore & Hong Kong To Become The World's Most Competitive Economy Again - #MAGA!Roseanne Barr is off TV but Samantha Bee is still on -- just another example of the media’s double standardThis timeline is unexpected. In 2018, I have already skipped a Star Wars movie in the theatres and paid money for a Kanye West Album.THE MADMAN-Probably the best quote in human history to date🐸 TOP SPICE OF THE DAY 🐸:"oh they're so good, oh they're so sweet."Today is Trump's 500th day as POTUS so here is a commemorative $500 bill.This triggers leftists.FITTON: My first official meme for the TD"Cuz we hate him"Monday, June 4th:TODAY'S ACTION:Vice President Pence Delivers Remarks at a Reception Promoting a Hemisphere of FreedomPresident Donald J. Trump Announces Intent to Nominate Personnel to a Key Administration PostPresidential Memorandum for the Secretary of StatePresidential Memorandum for the Secretary of StateEight Nominations Sent to the Senate Today🔥🔥TRUMP TWEETS🔥🔥:This is my 500th. Day in Office and we have accomplished a lot - many believe more than any President in his first 500 days. Massive Tax & Regulation Cuts, Military & Vets, Lower Crime & Illegal Immigration, Stronger Borders, Judgeships, Best Economy & Jobs EVER, and much more... ....We had Repeal & Replace done (and the saving to our country of one trillion dollars) except for one person, but it is getting done anyway. Individual Mandate is gone and great, less expensive plans will be announced this month. Drug prices coming down & Right to Try!“This is the best time EVER to look for a job.” James Freeman of WSJ.As has been stated by numerous legal scholars, I have the absolute right to PARDON myself, but why would I do that when I have done nothing wrong? In the meantime, the never ending Witch Hunt, led by 13 very Angry and Conflicted Democrats (& others) continues into the mid-terms!China already charges a tax of 16% on soybeans. Canada has all sorts of trade barriers on our Agricultural products. Not acceptable!The U.S. has made such bad trade deals over so many years that we can only WIN!Farmers have not been doing well for 15 years. Mexico, Canada, China and others have treated them unfairly. By the time I finish trade talks, that will change. Big trade barriers against U.S. farmers, and other businesses, will finally be broken. Massive trade deficits no longer!The appointment of the Special Counsel is totally UNCONSTITUTIONAL! Despite that, we play the game because I, unlike the Democrats, have done nothing wrong!#500Days of American Greatness: http://45.wh.gov/gNWs8uThe Fake News Media is desperate to distract from the economy and record setting economic numbers and so they keep talking about the phony Russian Witch Hunt.In many ways this is the greatest economy in the HISTORY of America and the best time EVER to look for a job!Big Supreme Court ruling for Baker just out!The Philadelphia Eagles Football Team was invited to the White House. Unfortunately, only a small number of players decided to come, and we canceled the event. Staying in the Locker Room for the playing of our National Anthem is as disrespectful to our country as kneeling. Sorry!SIGNIFICANT TWEETS AND NEWS:Supreme Court rules 7-2 in favor of Colorado baker who refused to bake a wedding cake for a gay couple on religious grounds. SCOTUS finds that the Colorado Civil Rights Commission did not consider this case with religious neutrality and violated the Free Exercise Clause.Stand for the Anthem or don’t come. I love this President.Watch Bernie Sanders Run From Alex Jones At LAX Airport29 Years ago Today. This is Communism. Never Forget.The media was all about an outgoing Obama pardoning Incoming Hillary. Then they were cool with Hillary pardoning herself. But now, because it’s DJT, now it’s a “constitutional crisis.” Sorry ass complicit jerk-offs.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:worst boycott ever #MAGAJust saw this on another sub. Pretty accurate tbhThis is America.BREAKING: In a narrow 2,623-487 county decision, Trump wins the US electionBREAKING: In narrow 77-0 decision, Oklahoma goes entirely Republican.Tuesday, June 5th:TODAY'S ACTION:President Trump Participates in the Celebration of AmericaHerschel Walker at the White House Sports and Fitness DayNatalie Gulbis at the White House Sports and Fitness DayPresident Trump Participates in the Signing Ceremony for S. 292🔥🔥TRUMP TWEETS🔥🔥:What is taking so long with the Inspector General’s Report on Crooked Hillary and Slippery James Comey. Numerous delays. Hope Report is not being changed and made weaker! There are so many horrible things to tell, the public has the right to know. Transparency!The U.S. has an increased economic value of more than 7 Trillion Dollars since the Election. May be the best economy in the history of our country. Record Jobs numbers. Nice!We will proudly be playing the National Anthem and other wonderful music celebrating our Country today at 3 P.M., The White House, with the United States Marine Band and the United States Army Chorus. Honoring America! NFL, no escaping to Locker Rooms!We have had many Championship teams recently at the White House including the Chicago Cubs, Houston Astros, Pittsburgh Penguins, New England Patriots, Alabama and Clemson National Champions, and many others. National Anthem & more great music today at 3:00 P.M.The Russian Witch Hunt Hoax continues, all because Jeff Sessions didn’t tell me he was going to recuse himself...I would have quickly picked someone else. So much time and money wasted, so many lives ruined...and Sessions knew better than most that there was No Collusion!Meeting in Singapore with North Korea will hopefully be the start of something big...we will soon [email protected] and Champion @MartinTruex_Jr were recently at the White House. It was a great day for a great sport!Separating families at the Border is the fault of bad legislation passed by the Democrats. Border Security laws should be changed but the Dems can’t get their act together! Started the Wall.In High Tax, High Crime California, be sure to get out and vote for Republican John Cox for Governor. He will make a BIG difference!Get the vote out in California today for Rep. Kevin McCarthy and all of the great GOP candidates for Congress. Keep our country out of the hands of High Tax, High Crime Nancy Pelosi.Vote for Congressman Devin Nunes, a true American Patriot the likes of which we rarely see in our modern day world....he truly loves our country and deserves everyone’s support!Senator @RogerWicker of Mississippi has done everything necessary to Make America Great Again! Get out and vote for Roger, he has my total support!Terrific new book out by the wonderful Harris Faulkner, “9 Rules of Engagement.” Harris shares lessons from a military family. Enjoy!The HISTORIC Rescissions Package we’ve proposed would cut $15,000,000,000 in Wasteful Spending! We are getting our government back on track.Imagine how much wasteful spending we’d save if we didn’t have Chuck and Nancy standing in our way! For years, Democrats in Congress have depleted our military and busted our budgets on needless spending, and to what end? No more.Wow, Strzok-Page, the incompetent & corrupt FBI lovers, have texts referring to a counter-intelligence operation into the Trump Campaign dating way back to December, 2015. SPYGATE is in full force! Is the Mainstream Media interested yet? Big stuff!(Retweeting Robby Starbuck) Fox News has been #1 for 197 months straight. In the latest ratings disaster for CNN they lost another 25% of their viewers. Fox has 10 of the top 15 shows and even hold the #1 spot in the younger key demo. The public is loudly rejecting @CNN.(Retweeting Eric Trump) #MakeAmericaGreatAgain 🇺🇸🇺🇸🇺🇸(Retweeting Brad Parscale) Since the #FakeNews is full of distortions, underreporting, and lies, we launched a platform tonight presenting a comprehensive record of @realDonaldTrump’s administration. The truth will be told about a remarkable 500-day record of accomplishments!Great interview by @LouDobbs with Chris Farrell of Judicial Watch concerning the governments counter-intelligence operation into the Trump Campaign. SPYGATE at the highest level. Who would believe? 10,534 replies 12,776 retweets 50,227 likesChris Farrell, Judicial Watch. “They were running an operation to undermine a candidate for President of the U.S. These are all violations of law. This is intelligence tradecraft to steer an election. There’s nothing more grave when it comes to abuse of our intelligence system... ... ...This is a level of criminality beyond the pale. This is such a grave abuse of power and authority, it’s like nothing else we’ve seen in our history. This makes the Nixon Watergate burglary look like keystone cop stuff....The greatest Witch Hunt in political history!Mitch McConnell announced he will cancel the Senate’s August Recess. Great, maybe the Democrats will finally get something done other than their acceptance of High Crime and High Taxes. We need Border Security!SIGNIFICANT TWEETS AND NEWS:For the first time in recorded American history the U.S. Department of Labor reports: Job openings exceed number of job seekers. (That.... Mr Obama is a fucking magic wand)TRUMP ON MIDTERMS: WE CANNOT BE COMPLACENT. GET OUT AND VOTE AL, IA, MS, MT, NJ, NM & SD!!Page/Strokz emails including the changing of the verbiage to exhonerate ClintonAndrew McCabe seeks immunity for testimony in congressional hearingTHIS IS YUUUUUUGE:U.S. Senate Majority Leader Mitch McConnell canceled the Senate's traditional August recess, citing Democrats' "historic obstruction" to pass legislation.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:The Blue Wave. Proof. It's Happening. The Democrats are "unstoppable".Different kids of diets😂 This past weekend #Antifa came out to play in the Pacific Northwest and did they ever get a surprise!GeniusDon't let the world forget KateTfw the OIG is taking so long with the report on Crooked Hillary and Slippery James ComeyWednesday, June 6th:TODAY'S ACTION:President Trump Participates in the Signing Ceremony for S. 2372 – VA Mission Act of 2018President Trump Signs VA Mission Act of 2018 into LawPresident Trump and Vice President Pence Attend the 2018 Hurricane Briefing at FEMA HQPresident Trump Delivers Remarks After the 2018 Hurricane Briefing at FEMA HQPresident Trump Hosts the White House IFTARPresident Donald J. Trump Announces Intent to Nominate and Appoint Personnel to Key Administration PostsPresident Donald J. Trump Announces Appointments for the Executive Office of the President🔥🔥TRUMP TWEETS🔥🔥:Great night for Republicans! Congratulations to John Cox on a really big number in California. He can win. Even Fake News CNN said the Trump impact was really big, much bigger than they ever thought possible. So much for the big Blue Wave, it may be a big Red Wave. Working hard!Gold Star father, Ceejay Metcalf, whose great son Michael was just honored at the White House, was fantastic this morning on @foxandfriends. He is a special man!The Fake News Media has been so unfair, and vicious, to my wife and our great First Lady, Melania. During her recovery from surgery they reported everything from near death, to facelift, to left the W.H. (and me) for N.Y. or Virginia, to abuse. All Fake, she is doing really well!...Four reporters spotted Melania in the White House last week walking merrily along to a meeting. They never reported the sighting because it would hurt the sick narrative that she was living in a different part of the world, was really ill, or whatever. Fake News is really bad!Many more Republican voters showed up yesterday than the Fake News thought possible. The political pundits just don’t get what is going on out there - or they do get it but refuse to report the facts! Remember, Dems are High Tax, High Crime, easy to beat!Congratulations to Dana Rohrabacher on his big California win. We are proud of you Dana!Today we mark another milestone: the 74th anniversary of #DDay, the Allied invasion of Normandy. On June 6, 1944, more than 70,000 brave young Americans charged out of landing craft, jumped out of airplanes, and stormed into hell...We must always protect those who protect us. Today, it was my great honor to sign the #VAMissionAct and to make Veterans Choice the permanent law of the land! http://45.wh.gov/dyWJNqThank you to everyone at @FEMA HQ for today’s briefing on preparations for the upcoming hurricane season. Disaster response and recovery is best achieved when it’s federally supported, state managed, and locally executed – this is the successful model we will continue to build.SIGNIFICANT TWEETS AND NEWS:Seventy-four years ago today American patriots fought and died by the thousands to stop real fascism, racial genocide, and oppression. Let's remember these brave Americans who gave it all so Soy Boys today can claim every patriotic American is a fascist and racist without a hint of irony. D-Day 44Steve Scalise back on the field today.BOMBSHELL REPORT: The Obama administration granted a license letting Iran access the United States financial system despite officials’ pledges that they would prohibit itPromisesKept.com President Donald J. Trump's AccomplishmentsHenry Winkler says he was among 118,000 voters 'left off' Los Angeles County rosters Fox NewsThe Most Ignored Bombshell of 2017: Samantha Power was caught using her security clearance as a UN ambassador to review private conversations by U.S. citizens 260 times in the 2016 election year... She said that someone else in the Obama White House did this, using her security clearance.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:This is AmericaThe most important comment I've ever made. If this message resonates with even one person then I will have made the world a better place.Commander of CheeseheadsMiss America crowned in advance! Judges cite her YUGE brains and charity work with mentally impaired media as key factors! Beautiful person!Thursday, June 7th:TODAY'S ACTION:They Said It Couldn't Be DonePresident Trumps Meets with the Prime Minister of JapanPresident Trump Hosts a Joint Press Conference with the Prime Minister of JapanPresident Trump Welcomes Prime Minister Shinzō Abe of Japan to the White House[]()🔥🔥TRUMP TWEETS🔥🔥:Isn’t it Ironic? Getting ready to go to the G-7 in Canada to fight for our country on Trade (we have the worst trade deals ever made), then off to Singapore to meet with North Korea & the Nuclear Problem...But back home we still have the 13 Angry Democrats pushing the Witch Hunt!Good luck to Alice Johnson. Have a wonderful life!Alan Dershowitz, Harvard Law Professor: “It all proves that we never needed a Special Counsel....All of this could have been done by the Justice Dept. Don’t need a multi-million dollar group of people with a target on someone’s back. Not the way Justice should operate.” So true!When and where will all of the many conflicts of interest be listed by the 13 Angry Democrats (plus) working on the Witch Hunt Hoax. There has never been a group of people on a case so biased or conflicted. It is all a Democrat Excuse for LOSING the Election. Where is the server?How could Jeff Flake, who is setting record low polling numbers in Arizona and was therefore humiliatingly forced out of his own Senate seat without even a fight (and who doesn’t have a clue), think about running for office, even a lower one, again? Let’s face it, he’s a Flake!Looking forward to seeing my friend Prime Minister @AbeShinzo of Japan at noon. Will be discussing North Korea and Trade.Our Justice Department must not let Awan & Debbie Wasserman Schultz off the hook. The Democrat I.T. scandal is a key to much of the corruption we see today. They want to make a “plea deal” to hide what is on their Server. Where is Server? Really bad!When will people start saying, “thank you, Mr. President, for firing James Comey?”The Obama Administration is now accused of trying to give Iran secret access to the financial system of the United States. This is totally illegal. Perhaps we could get the 13 Angry Democrats to divert some of their energy to this “matter” (as Comey would call it). Investigate!“Total jobless claims running at lowest level in 44 years”“$3 billion payoff: 101 utilities cut rates, credit GOP tax cuts”MAKING AMERICA GREAT AGAIN!It’s my great honor to welcome Prime Minister @AbeShinzo back to the @WhiteHouse!🇺🇸🇯🇵Today, I am greatly honored to welcome my good friend, PM Abe of Japan to the @WhiteHouse. Over the past 16 months the Prime Minister and I have worked closely together to address common challenges, of which there are many...PM Abe and I are also working to improve the trading relationship between the U.S. and Japan, something we have to do. The U.S. seeks a bilateral deal with Japan that is based on the principle of fairness and reciprocity. We’re working hard to reduce our trade imbalance...Great day of meetings with Prime Minister @AbeShinzo of Japan!Please tell Prime Minister Trudeau and President Macron that they are charging the U.S. massive tariffs and create non-monetary barriers. The EU trade surplus with the U.S. is $151 Billion, and Canada keeps our farmers and others out. Look forward to seeing them tomorrow.Prime Minister Trudeau is being so indignant, bringing up the relationship that the U.S. and Canada had over the many years and all sorts of other things...but he doesn’t bring up the fact that they charge us up to 300% on dairy — hurting our Farmers, killing our Agriculture!Why isn’t the European Union and Canada informing the public that for years they have used massive Trade Tariffs and non-monetary Trade Barriers against the U.S. Totally unfair to our farmers, workers & companies. Take down your tariffs & barriers or we will more than match you!SIGNIFICANT TWEETS AND NEWS:OUTRAGEOUS! New IG Report - Social Security Benefits paid to DACA! Illegals are receiving OUR Social Security Benefits!The Kent State 2A girl is a god-tier shitposter.MSNBC Calls Daughter Of Pardoned Alice Johnson — She Can’t Stop Thanking TrumpTime Magazine honors Trump again!!! Beautiful cover. The left can’t meme.LOL! Sean Hannity is trending on Twitter because he jokingly told "witnesses" to smash their phones with hammers before handing them over to Mueller. Stupid Liberals are saying he is tampering with evidence. They probably dont know thats what Hillary actually did.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:This is AmericaGrandfather was born a slave, mother was born a refugee, I was born freeThere are only 2 genders, and if you disagree then you're an Islamophobe. Leftist SJWs BTFO!Mirror, Mirror on THE WALL, who's the WOKEST of us ALL??Friday, June 8th:TODAY'S ACTION:President Donald J. Trump Proclaims June 14, 2018 as Flag Day and the Week Starting June 10, 2018 as National Flag WeekPresident Trump Delivers a Statement Upon DeparturePresident Trump Participates in an Expanded Bilateral Meeting with the Prime Minister of CanadaPresident Trump Participates in a Bilateral Meeting with the President of the French Republic🔥🔥TRUMP TWEETS🔥🔥:Obama, Schumer and Pelosi did NOTHING about North Korea, and now weak on Crime, High Tax Schumer is telling me what to do at the Summit the Dems could never set up. Schumer failed with North Korea and Iran, we don’t need his advice!Canada charges the U.S. a 270% tariff on Dairy Products! They didn’t tell you that, did they? Not fair to our farmers!Looking forward to straightening out unfair Trade Deals with the G-7 countries. If it doesn’t happen, we come out even better!Congratulations to the Washington Capitals on their GREAT play and winning the Stanley Cup Championship. Alex Ovechkin, the team captain, was spectacular - a true Superstar! D.C. is popping, in many ways. What a time!I am heading for Canada and the G-7 for talks that will mostly center on the long time unfair trade practiced against the United States. From there I go to Singapore and talks with North Korea on Denuclearization. Won’t be talking about the Russian Witch Hunt Hoax for a while!My thoughts and prayers are with the families of our serviceman who was killed and his fellow servicemen who were wounded in Somalia. They are truly all HEROES.(Retweeting G7 Canada) Day 1 of #G7Charlevoix in 60 seconds.SIGNIFICANT TWEETS AND NEWS:President Trump confirms intent to sign states' rights cannabis bill that was introduced in Congress yesterdayPewdiepie reuploads video exposing CNN and Hillary Clinton after it got copystriked and deleted!BAHAHAHAHAHA.............BAHAJSJSKGLGOGICSteam refuses to bend the knee to SJWs, choosing to stand with community - All content that is legal will be allowed.BREAKING: Trump tells kneeling NFL players to recommend people to pardon, since that's what they're supposedly protesting. Their reason to kneel just died. LOL🐸 TOP SPICE OF THE DAY 🐸:When you're surrounded by globalistsPresstitutesHookers for Hillary, I should have known...ARCHIVE: "Sleeping with your source- especially a vindictive congressman?" - Ali Watkins, 2013Saturday, June 10th:TODAY'S ACTION:President Trump delivers a statementSIGNIFICANT TWEETS AND NEWS:Ali Watkins not getting the probe she had hoped for; Feds have seized her email and phone records for investigation on James Wolfe!HOLY SHIT Last night Bill Maher said what every lefitist truly thinks but might not say out loud: That he HOPES FOR A RECESSION to hurt President Trump. They'd rather see our country fail if it means Trump won't succeed. This is peak Trump derangement, folks. SAD!James Wolfe Leak Investigation: Journalists Insist on a Double Standard - Andrew McCarthyNew italian PM Conte on Facebook: Historic alliance, new friendship 🤝 - Can't get tired of all this winning, MAGA and MIGA!!! 🍝🍔BREAKING: Seth Rich's Brother's Attorneys Subpoena Twitter to Turn Over All Direct Messages from: Wikileaks, Julian Assange, KimDotCom, Cassandra Fairbanks, Gateway Pundit, etc🐸 TOP SPICE OF THE DAY 🐸:The God Emperor and his court JesterUSA and Canada 🇺🇲🇨🇦Not a drill: European Union banning memes (seriously).Dressed up for me best friend Melania.So Much Winning, STILL NOT TIRED OF IT!!As always, some tunes to get you jamming through this long list of winning;Ghost Town4th DimensionNo MistakesWatchWhat Would Meek do?MAGA ON PATRIOTS!Submitted June 09, 2018 at 11:48AM by Ivaginaryfriend https://www.reddit.com/The\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_Donald/comments/8ptnk6/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /The_DonaldSubmitted June 09, 2018 at 12:48PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pu2ln/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pun4d/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 06:13PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pwc8s/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 07:13PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pwpq2/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 08:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pxdfj/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 10:18PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pxu3a/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 11:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pydsj/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 12:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pynsafternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 02:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pz72afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 03:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pzfe1/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 06:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q02kv/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 08:43AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q0jrp/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 09:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q0s8t/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 10:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q1bf2/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 12:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q1y1t/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q2m9o/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 05:28PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q41fu/afternoon\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 06:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q4hwafternoon\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 08:23PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q57mj/afternoon\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 09:28PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q5lxs/afternoon\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 11:48PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q6hj6/afternoon\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 12:18AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q6o1m/afternoon\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 01:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q71kt/afternoon\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 02:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q7hym/afternoon\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 03:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q7sgi/afternoon\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 06:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q8lkv/afternoon\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 08:23AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q93tt/afternoon\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 09:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q9iv4/afternoon\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\_your\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 10:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qa4xafternoon\\\\\\\\\\\\_magathread\\\\\\\\\\\\_your\\\\\\\\\\\\_weekly\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 12:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qavpx/afternoon\\\\\\\\\\\_magathread\\\\\\\\\\\_your\\\\\\\\\\\_weekly\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qbjwj/afternoon\\\\\\\\\\_magathread\\\\\\\\\\_your\\\\\\\\\\_weekly\\\\\\\\\\_presidential/?utm\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 06:38PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qdrii/afternoon\\\\\\\\\_magathread\\\\\\\\\_your\\\\\\\\\_weekly\\\\\\\\\_presidential/?utm\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 08:23PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qehmo/afternoon\\\\\\\\_magathread\\\\\\\\_your\\\\\\\\_weekly\\\\\\\\_presidential/?utm\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 09:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qf511/afternoon\\\\\\\_magathread\\\\\\\_your\\\\\\\_weekly\\\\\\\_presidential/?utm\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 11:18PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qfobv/afternoon\\\\\\_magathread\\\\\\_your\\\\\\_weekly\\\\\\_presidential/?utm\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 01:38AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qghk4/afternoon\\\\\_magathread\\\\\_your\\\\\_weekly\\\\\_presidential/?utm\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 02:38AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qgspl/afternoon\\\\_magathread\\\\_your\\\\_weekly\\\\_presidential/?utm\\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 07:03AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qi1pi/afternoon\\\_magathread\\\_your\\\_weekly\\\_presidential/?utm\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 08:13AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qifwi/afternoon\\_magathread\\_your\\_weekly\\_presidential/?utm\\_source=iftttvia /MagaFirstNews
Submitted June 12, 2018 at 09:33AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qiyie/afternoon\_magathread\_your\_weekly\_presidential/?utm\_source=ifttt
via /MagaFirstNews
submitted by peterboykin to MagaFirstNews [link] [comments]


2018.06.12 15:33 peterboykin Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!

Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!
Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!HAPPPPPPY SATURDAY, PATRIOTS!This is your girl u/IvaginaryFriend back at it again with a weeks worth of spice for you lovely Deplorables! (◠‿◠✿)Before we officially get this recap started, if you happened to miss any past recaps you can catch them here!Also, don't forget about our Header contest coming up on Monday, June 11th!!! The winning submission will be proudly presented at the top of the DOM for the next few months!!!Now, let's get on with the show!Sunday, June 3rd:🔥🔥TRUMP TWEETS🔥🔥:Jesse Watters “The only thing Trump obstructed was Hillary getting to the White House.” So true!As only one of two people left who could become President, why wouldn’t the FBI or Department of “Justice” have told me that they were secretly investigating Paul Manafort (on charges that were 10 years old and had been previously dropped) during my campaign? Should have told me!....Paul Manafort came into the campaign very late and was with us for a short period of time (he represented Ronald Reagan, Bob Dole & many others over the years), but we should have been told that Comey and the boys were doing a number on him, and he wouldn’t have been hired!Mark Penn “Why are there people from the Clinton Foundation on the Mueller Staff? Why is there an Independent Counsel? To go after people and their families for unrelated offenses...Constitution was set up to prevent this...Stormtrooper tactics almost.” A disgrace!SIGNIFICANT TWEETS AND NEWS:WINNING! U.S. Beats Singapore & Hong Kong To Become The World's Most Competitive Economy Again - #MAGA!Roseanne Barr is off TV but Samantha Bee is still on -- just another example of the media’s double standardThis timeline is unexpected. In 2018, I have already skipped a Star Wars movie in the theatres and paid money for a Kanye West Album.THE MADMAN-Probably the best quote in human history to date🐸 TOP SPICE OF THE DAY 🐸:"oh they're so good, oh they're so sweet."Today is Trump's 500th day as POTUS so here is a commemorative $500 bill.This triggers leftists.FITTON: My first official meme for the TD"Cuz we hate him"Monday, June 4th:TODAY'S ACTION:Vice President Pence Delivers Remarks at a Reception Promoting a Hemisphere of FreedomPresident Donald J. Trump Announces Intent to Nominate Personnel to a Key Administration PostPresidential Memorandum for the Secretary of StatePresidential Memorandum for the Secretary of StateEight Nominations Sent to the Senate Today🔥🔥TRUMP TWEETS🔥🔥:This is my 500th. Day in Office and we have accomplished a lot - many believe more than any President in his first 500 days. Massive Tax & Regulation Cuts, Military & Vets, Lower Crime & Illegal Immigration, Stronger Borders, Judgeships, Best Economy & Jobs EVER, and much more... ....We had Repeal & Replace done (and the saving to our country of one trillion dollars) except for one person, but it is getting done anyway. Individual Mandate is gone and great, less expensive plans will be announced this month. Drug prices coming down & Right to Try!“This is the best time EVER to look for a job.” James Freeman of WSJ.As has been stated by numerous legal scholars, I have the absolute right to PARDON myself, but why would I do that when I have done nothing wrong? In the meantime, the never ending Witch Hunt, led by 13 very Angry and Conflicted Democrats (& others) continues into the mid-terms!China already charges a tax of 16% on soybeans. Canada has all sorts of trade barriers on our Agricultural products. Not acceptable!The U.S. has made such bad trade deals over so many years that we can only WIN!Farmers have not been doing well for 15 years. Mexico, Canada, China and others have treated them unfairly. By the time I finish trade talks, that will change. Big trade barriers against U.S. farmers, and other businesses, will finally be broken. Massive trade deficits no longer!The appointment of the Special Counsel is totally UNCONSTITUTIONAL! Despite that, we play the game because I, unlike the Democrats, have done nothing wrong!#500Days of American Greatness: http://45.wh.gov/gNWs8uThe Fake News Media is desperate to distract from the economy and record setting economic numbers and so they keep talking about the phony Russian Witch Hunt.In many ways this is the greatest economy in the HISTORY of America and the best time EVER to look for a job!Big Supreme Court ruling for Baker just out!The Philadelphia Eagles Football Team was invited to the White House. Unfortunately, only a small number of players decided to come, and we canceled the event. Staying in the Locker Room for the playing of our National Anthem is as disrespectful to our country as kneeling. Sorry!SIGNIFICANT TWEETS AND NEWS:Supreme Court rules 7-2 in favor of Colorado baker who refused to bake a wedding cake for a gay couple on religious grounds. SCOTUS finds that the Colorado Civil Rights Commission did not consider this case with religious neutrality and violated the Free Exercise Clause.Stand for the Anthem or don’t come. I love this President.Watch Bernie Sanders Run From Alex Jones At LAX Airport29 Years ago Today. This is Communism. Never Forget.The media was all about an outgoing Obama pardoning Incoming Hillary. Then they were cool with Hillary pardoning herself. But now, because it’s DJT, now it’s a “constitutional crisis.” Sorry ass complicit jerk-offs.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:worst boycott ever #MAGAJust saw this on another sub. Pretty accurate tbhThis is America.BREAKING: In a narrow 2,623-487 county decision, Trump wins the US electionBREAKING: In narrow 77-0 decision, Oklahoma goes entirely Republican.Tuesday, June 5th:TODAY'S ACTION:President Trump Participates in the Celebration of AmericaHerschel Walker at the White House Sports and Fitness DayNatalie Gulbis at the White House Sports and Fitness DayPresident Trump Participates in the Signing Ceremony for S. 292🔥🔥TRUMP TWEETS🔥🔥:What is taking so long with the Inspector General’s Report on Crooked Hillary and Slippery James Comey. Numerous delays. Hope Report is not being changed and made weaker! There are so many horrible things to tell, the public has the right to know. Transparency!The U.S. has an increased economic value of more than 7 Trillion Dollars since the Election. May be the best economy in the history of our country. Record Jobs numbers. Nice!We will proudly be playing the National Anthem and other wonderful music celebrating our Country today at 3 P.M., The White House, with the United States Marine Band and the United States Army Chorus. Honoring America! NFL, no escaping to Locker Rooms!We have had many Championship teams recently at the White House including the Chicago Cubs, Houston Astros, Pittsburgh Penguins, New England Patriots, Alabama and Clemson National Champions, and many others. National Anthem & more great music today at 3:00 P.M.The Russian Witch Hunt Hoax continues, all because Jeff Sessions didn’t tell me he was going to recuse himself...I would have quickly picked someone else. So much time and money wasted, so many lives ruined...and Sessions knew better than most that there was No Collusion!Meeting in Singapore with North Korea will hopefully be the start of something big...we will soon [email protected] and Champion @MartinTruex_Jr were recently at the White House. It was a great day for a great sport!Separating families at the Border is the fault of bad legislation passed by the Democrats. Border Security laws should be changed but the Dems can’t get their act together! Started the Wall.In High Tax, High Crime California, be sure to get out and vote for Republican John Cox for Governor. He will make a BIG difference!Get the vote out in California today for Rep. Kevin McCarthy and all of the great GOP candidates for Congress. Keep our country out of the hands of High Tax, High Crime Nancy Pelosi.Vote for Congressman Devin Nunes, a true American Patriot the likes of which we rarely see in our modern day world....he truly loves our country and deserves everyone’s support!Senator @RogerWicker of Mississippi has done everything necessary to Make America Great Again! Get out and vote for Roger, he has my total support!Terrific new book out by the wonderful Harris Faulkner, “9 Rules of Engagement.” Harris shares lessons from a military family. Enjoy!The HISTORIC Rescissions Package we’ve proposed would cut $15,000,000,000 in Wasteful Spending! We are getting our government back on track.Imagine how much wasteful spending we’d save if we didn’t have Chuck and Nancy standing in our way! For years, Democrats in Congress have depleted our military and busted our budgets on needless spending, and to what end? No more.Wow, Strzok-Page, the incompetent & corrupt FBI lovers, have texts referring to a counter-intelligence operation into the Trump Campaign dating way back to December, 2015. SPYGATE is in full force! Is the Mainstream Media interested yet? Big stuff!(Retweeting Robby Starbuck) Fox News has been #1 for 197 months straight. In the latest ratings disaster for CNN they lost another 25% of their viewers. Fox has 10 of the top 15 shows and even hold the #1 spot in the younger key demo. The public is loudly rejecting @CNN.(Retweeting Eric Trump) #MakeAmericaGreatAgain 🇺🇸🇺🇸🇺🇸(Retweeting Brad Parscale) Since the #FakeNews is full of distortions, underreporting, and lies, we launched a platform tonight presenting a comprehensive record of @realDonaldTrump’s administration. The truth will be told about a remarkable 500-day record of accomplishments!Great interview by @LouDobbs with Chris Farrell of Judicial Watch concerning the governments counter-intelligence operation into the Trump Campaign. SPYGATE at the highest level. Who would believe? 10,534 replies 12,776 retweets 50,227 likesChris Farrell, Judicial Watch. “They were running an operation to undermine a candidate for President of the U.S. These are all violations of law. This is intelligence tradecraft to steer an election. There’s nothing more grave when it comes to abuse of our intelligence system... ... ...This is a level of criminality beyond the pale. This is such a grave abuse of power and authority, it’s like nothing else we’ve seen in our history. This makes the Nixon Watergate burglary look like keystone cop stuff....The greatest Witch Hunt in political history!Mitch McConnell announced he will cancel the Senate’s August Recess. Great, maybe the Democrats will finally get something done other than their acceptance of High Crime and High Taxes. We need Border Security!SIGNIFICANT TWEETS AND NEWS:For the first time in recorded American history the U.S. Department of Labor reports: Job openings exceed number of job seekers. (That.... Mr Obama is a fucking magic wand)TRUMP ON MIDTERMS: WE CANNOT BE COMPLACENT. GET OUT AND VOTE AL, IA, MS, MT, NJ, NM & SD!!Page/Strokz emails including the changing of the verbiage to exhonerate ClintonAndrew McCabe seeks immunity for testimony in congressional hearingTHIS IS YUUUUUUGE:U.S. Senate Majority Leader Mitch McConnell canceled the Senate's traditional August recess, citing Democrats' "historic obstruction" to pass legislation.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:The Blue Wave. Proof. It's Happening. The Democrats are "unstoppable".Different kids of diets😂 This past weekend #Antifa came out to play in the Pacific Northwest and did they ever get a surprise!GeniusDon't let the world forget KateTfw the OIG is taking so long with the report on Crooked Hillary and Slippery James ComeyWednesday, June 6th:TODAY'S ACTION:President Trump Participates in the Signing Ceremony for S. 2372 – VA Mission Act of 2018President Trump Signs VA Mission Act of 2018 into LawPresident Trump and Vice President Pence Attend the 2018 Hurricane Briefing at FEMA HQPresident Trump Delivers Remarks After the 2018 Hurricane Briefing at FEMA HQPresident Trump Hosts the White House IFTARPresident Donald J. Trump Announces Intent to Nominate and Appoint Personnel to Key Administration PostsPresident Donald J. Trump Announces Appointments for the Executive Office of the President🔥🔥TRUMP TWEETS🔥🔥:Great night for Republicans! Congratulations to John Cox on a really big number in California. He can win. Even Fake News CNN said the Trump impact was really big, much bigger than they ever thought possible. So much for the big Blue Wave, it may be a big Red Wave. Working hard!Gold Star father, Ceejay Metcalf, whose great son Michael was just honored at the White House, was fantastic this morning on @foxandfriends. He is a special man!The Fake News Media has been so unfair, and vicious, to my wife and our great First Lady, Melania. During her recovery from surgery they reported everything from near death, to facelift, to left the W.H. (and me) for N.Y. or Virginia, to abuse. All Fake, she is doing really well!...Four reporters spotted Melania in the White House last week walking merrily along to a meeting. They never reported the sighting because it would hurt the sick narrative that she was living in a different part of the world, was really ill, or whatever. Fake News is really bad!Many more Republican voters showed up yesterday than the Fake News thought possible. The political pundits just don’t get what is going on out there - or they do get it but refuse to report the facts! Remember, Dems are High Tax, High Crime, easy to beat!Congratulations to Dana Rohrabacher on his big California win. We are proud of you Dana!Today we mark another milestone: the 74th anniversary of #DDay, the Allied invasion of Normandy. On June 6, 1944, more than 70,000 brave young Americans charged out of landing craft, jumped out of airplanes, and stormed into hell...We must always protect those who protect us. Today, it was my great honor to sign the #VAMissionAct and to make Veterans Choice the permanent law of the land! http://45.wh.gov/dyWJNqThank you to everyone at @FEMA HQ for today’s briefing on preparations for the upcoming hurricane season. Disaster response and recovery is best achieved when it’s federally supported, state managed, and locally executed – this is the successful model we will continue to build.SIGNIFICANT TWEETS AND NEWS:Seventy-four years ago today American patriots fought and died by the thousands to stop real fascism, racial genocide, and oppression. Let's remember these brave Americans who gave it all so Soy Boys today can claim every patriotic American is a fascist and racist without a hint of irony. D-Day 44Steve Scalise back on the field today.BOMBSHELL REPORT: The Obama administration granted a license letting Iran access the United States financial system despite officials’ pledges that they would prohibit itPromisesKept.com President Donald J. Trump's AccomplishmentsHenry Winkler says he was among 118,000 voters 'left off' Los Angeles County rosters Fox NewsThe Most Ignored Bombshell of 2017: Samantha Power was caught using her security clearance as a UN ambassador to review private conversations by U.S. citizens 260 times in the 2016 election year... She said that someone else in the Obama White House did this, using her security clearance.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:This is AmericaThe most important comment I've ever made. If this message resonates with even one person then I will have made the world a better place.Commander of CheeseheadsMiss America crowned in advance! Judges cite her YUGE brains and charity work with mentally impaired media as key factors! Beautiful person!Thursday, June 7th:TODAY'S ACTION:They Said It Couldn't Be DonePresident Trumps Meets with the Prime Minister of JapanPresident Trump Hosts a Joint Press Conference with the Prime Minister of JapanPresident Trump Welcomes Prime Minister Shinzō Abe of Japan to the White House[]()🔥🔥TRUMP TWEETS🔥🔥:Isn’t it Ironic? Getting ready to go to the G-7 in Canada to fight for our country on Trade (we have the worst trade deals ever made), then off to Singapore to meet with North Korea & the Nuclear Problem...But back home we still have the 13 Angry Democrats pushing the Witch Hunt!Good luck to Alice Johnson. Have a wonderful life!Alan Dershowitz, Harvard Law Professor: “It all proves that we never needed a Special Counsel....All of this could have been done by the Justice Dept. Don’t need a multi-million dollar group of people with a target on someone’s back. Not the way Justice should operate.” So true!When and where will all of the many conflicts of interest be listed by the 13 Angry Democrats (plus) working on the Witch Hunt Hoax. There has never been a group of people on a case so biased or conflicted. It is all a Democrat Excuse for LOSING the Election. Where is the server?How could Jeff Flake, who is setting record low polling numbers in Arizona and was therefore humiliatingly forced out of his own Senate seat without even a fight (and who doesn’t have a clue), think about running for office, even a lower one, again? Let’s face it, he’s a Flake!Looking forward to seeing my friend Prime Minister @AbeShinzo of Japan at noon. Will be discussing North Korea and Trade.Our Justice Department must not let Awan & Debbie Wasserman Schultz off the hook. The Democrat I.T. scandal is a key to much of the corruption we see today. They want to make a “plea deal” to hide what is on their Server. Where is Server? Really bad!When will people start saying, “thank you, Mr. President, for firing James Comey?”The Obama Administration is now accused of trying to give Iran secret access to the financial system of the United States. This is totally illegal. Perhaps we could get the 13 Angry Democrats to divert some of their energy to this “matter” (as Comey would call it). Investigate!“Total jobless claims running at lowest level in 44 years”“$3 billion payoff: 101 utilities cut rates, credit GOP tax cuts”MAKING AMERICA GREAT AGAIN!It’s my great honor to welcome Prime Minister @AbeShinzo back to the @WhiteHouse!🇺🇸🇯🇵Today, I am greatly honored to welcome my good friend, PM Abe of Japan to the @WhiteHouse. Over the past 16 months the Prime Minister and I have worked closely together to address common challenges, of which there are many...PM Abe and I are also working to improve the trading relationship between the U.S. and Japan, something we have to do. The U.S. seeks a bilateral deal with Japan that is based on the principle of fairness and reciprocity. We’re working hard to reduce our trade imbalance...Great day of meetings with Prime Minister @AbeShinzo of Japan!Please tell Prime Minister Trudeau and President Macron that they are charging the U.S. massive tariffs and create non-monetary barriers. The EU trade surplus with the U.S. is $151 Billion, and Canada keeps our farmers and others out. Look forward to seeing them tomorrow.Prime Minister Trudeau is being so indignant, bringing up the relationship that the U.S. and Canada had over the many years and all sorts of other things...but he doesn’t bring up the fact that they charge us up to 300% on dairy — hurting our Farmers, killing our Agriculture!Why isn’t the European Union and Canada informing the public that for years they have used massive Trade Tariffs and non-monetary Trade Barriers against the U.S. Totally unfair to our farmers, workers & companies. Take down your tariffs & barriers or we will more than match you!SIGNIFICANT TWEETS AND NEWS:OUTRAGEOUS! New IG Report - Social Security Benefits paid to DACA! Illegals are receiving OUR Social Security Benefits!The Kent State 2A girl is a god-tier shitposter.MSNBC Calls Daughter Of Pardoned Alice Johnson — She Can’t Stop Thanking TrumpTime Magazine honors Trump again!!! Beautiful cover. The left can’t meme.LOL! Sean Hannity is trending on Twitter because he jokingly told "witnesses" to smash their phones with hammers before handing them over to Mueller. Stupid Liberals are saying he is tampering with evidence. They probably dont know thats what Hillary actually did.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:This is AmericaGrandfather was born a slave, mother was born a refugee, I was born freeThere are only 2 genders, and if you disagree then you're an Islamophobe. Leftist SJWs BTFO!Mirror, Mirror on THE WALL, who's the WOKEST of us ALL??Friday, June 8th:TODAY'S ACTION:President Donald J. Trump Proclaims June 14, 2018 as Flag Day and the Week Starting June 10, 2018 as National Flag WeekPresident Trump Delivers a Statement Upon DeparturePresident Trump Participates in an Expanded Bilateral Meeting with the Prime Minister of CanadaPresident Trump Participates in a Bilateral Meeting with the President of the French Republic🔥🔥TRUMP TWEETS🔥🔥:Obama, Schumer and Pelosi did NOTHING about North Korea, and now weak on Crime, High Tax Schumer is telling me what to do at the Summit the Dems could never set up. Schumer failed with North Korea and Iran, we don’t need his advice!Canada charges the U.S. a 270% tariff on Dairy Products! They didn’t tell you that, did they? Not fair to our farmers!Looking forward to straightening out unfair Trade Deals with the G-7 countries. If it doesn’t happen, we come out even better!Congratulations to the Washington Capitals on their GREAT play and winning the Stanley Cup Championship. Alex Ovechkin, the team captain, was spectacular - a true Superstar! D.C. is popping, in many ways. What a time!I am heading for Canada and the G-7 for talks that will mostly center on the long time unfair trade practiced against the United States. From there I go to Singapore and talks with North Korea on Denuclearization. Won’t be talking about the Russian Witch Hunt Hoax for a while!My thoughts and prayers are with the families of our serviceman who was killed and his fellow servicemen who were wounded in Somalia. They are truly all HEROES.(Retweeting G7 Canada) Day 1 of #G7Charlevoix in 60 seconds.SIGNIFICANT TWEETS AND NEWS:President Trump confirms intent to sign states' rights cannabis bill that was introduced in Congress yesterdayPewdiepie reuploads video exposing CNN and Hillary Clinton after it got copystriked and deleted!BAHAHAHAHAHA.............BAHAJSJSKGLGOGICSteam refuses to bend the knee to SJWs, choosing to stand with community - All content that is legal will be allowed.BREAKING: Trump tells kneeling NFL players to recommend people to pardon, since that's what they're supposedly protesting. Their reason to kneel just died. LOL🐸 TOP SPICE OF THE DAY 🐸:When you're surrounded by globalistsPresstitutesHookers for Hillary, I should have known...ARCHIVE: "Sleeping with your source- especially a vindictive congressman?" - Ali Watkins, 2013Saturday, June 10th:TODAY'S ACTION:President Trump delivers a statementSIGNIFICANT TWEETS AND NEWS:Ali Watkins not getting the probe she had hoped for; Feds have seized her email and phone records for investigation on James Wolfe!HOLY SHIT Last night Bill Maher said what every lefitist truly thinks but might not say out loud: That he HOPES FOR A RECESSION to hurt President Trump. They'd rather see our country fail if it means Trump won't succeed. This is peak Trump derangement, folks. SAD!James Wolfe Leak Investigation: Journalists Insist on a Double Standard - Andrew McCarthyNew italian PM Conte on Facebook: Historic alliance, new friendship 🤝 - Can't get tired of all this winning, MAGA and MIGA!!! 🍝🍔BREAKING: Seth Rich's Brother's Attorneys Subpoena Twitter to Turn Over All Direct Messages from: Wikileaks, Julian Assange, KimDotCom, Cassandra Fairbanks, Gateway Pundit, etc🐸 TOP SPICE OF THE DAY 🐸:The God Emperor and his court JesterUSA and Canada 🇺🇲🇨🇦Not a drill: European Union banning memes (seriously).Dressed up for me best friend Melania.So Much Winning, STILL NOT TIRED OF IT!!As always, some tunes to get you jamming through this long list of winning;Ghost Town4th DimensionNo MistakesWatchWhat Would Meek do?MAGA ON PATRIOTS!Submitted June 09, 2018 at 11:48AM by Ivaginaryfriend https://www.reddit.com/The\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_Donald/comments/8ptnk6/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /The_DonaldSubmitted June 09, 2018 at 12:48PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pu2ln/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pun4d/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 06:13PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pwc8s/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 07:13PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pwpq2/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 08:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pxdfj/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 10:18PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pxu3a/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 11:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pydsj/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 12:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pynsafternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 02:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pz72afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 03:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pzfe1/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 06:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q02kv/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 08:43AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q0jrp/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 09:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q0s8t/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 10:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q1bf2/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 12:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q1y1t/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q2m9o/afternoon\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 05:28PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q41fu/afternoon\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 06:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q4hwafternoon\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 08:23PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q57mj/afternoon\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 09:28PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q5lxs/afternoon\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 11:48PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q6hj6/afternoon\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 12:18AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q6o1m/afternoon\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 01:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q71kt/afternoon\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 02:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q7hym/afternoon\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 03:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q7sgi/afternoon\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 06:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q8lkv/afternoon\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 08:23AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q93tt/afternoon\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\_your\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 09:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q9iv4/afternoon\\\\\\\\\\\\_magathread\\\\\\\\\\\\_your\\\\\\\\\\\\_weekly\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 10:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qa4xafternoon\\\\\\\\\\\_magathread\\\\\\\\\\\_your\\\\\\\\\\\_weekly\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 12:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qavpx/afternoon\\\\\\\\\\_magathread\\\\\\\\\\_your\\\\\\\\\\_weekly\\\\\\\\\\_presidential/?utm\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qbjwj/afternoon\\\\\\\\\_magathread\\\\\\\\\_your\\\\\\\\\_weekly\\\\\\\\\_presidential/?utm\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 06:38PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qdrii/afternoon\\\\\\\\_magathread\\\\\\\\_your\\\\\\\\_weekly\\\\\\\\_presidential/?utm\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 08:23PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qehmo/afternoon\\\\\\\_magathread\\\\\\\_your\\\\\\\_weekly\\\\\\\_presidential/?utm\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 09:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qf511/afternoon\\\\\\_magathread\\\\\\_your\\\\\\_weekly\\\\\\_presidential/?utm\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 11:18PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qfobv/afternoon\\\\\_magathread\\\\\_your\\\\\_weekly\\\\\_presidential/?utm\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 01:38AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qghk4/afternoon\\\\_magathread\\\\_your\\\\_weekly\\\\_presidential/?utm\\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 02:38AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qgspl/afternoon\\\_magathread\\\_your\\\_weekly\\\_presidential/?utm\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 07:03AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qi1pi/afternoon\\_magathread\\_your\\_weekly\\_presidential/?utm\\_source=iftttvia /MagaFirstNews
Submitted June 12, 2018 at 08:13AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qifwi/afternoon\_magathread\_your\_weekly\_presidential/?utm\_source=ifttt
via /MagaFirstNews
submitted by peterboykin to MagaFirstNews [link] [comments]


2018.06.12 14:13 peterboykin Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!

Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!
Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!HAPPPPPPY SATURDAY, PATRIOTS!This is your girl u/IvaginaryFriend back at it again with a weeks worth of spice for you lovely Deplorables! (◠‿◠✿)Before we officially get this recap started, if you happened to miss any past recaps you can catch them here!Also, don't forget about our Header contest coming up on Monday, June 11th!!! The winning submission will be proudly presented at the top of the DOM for the next few months!!!Now, let's get on with the show!Sunday, June 3rd:🔥🔥TRUMP TWEETS🔥🔥:Jesse Watters “The only thing Trump obstructed was Hillary getting to the White House.” So true!As only one of two people left who could become President, why wouldn’t the FBI or Department of “Justice” have told me that they were secretly investigating Paul Manafort (on charges that were 10 years old and had been previously dropped) during my campaign? Should have told me!....Paul Manafort came into the campaign very late and was with us for a short period of time (he represented Ronald Reagan, Bob Dole & many others over the years), but we should have been told that Comey and the boys were doing a number on him, and he wouldn’t have been hired!Mark Penn “Why are there people from the Clinton Foundation on the Mueller Staff? Why is there an Independent Counsel? To go after people and their families for unrelated offenses...Constitution was set up to prevent this...Stormtrooper tactics almost.” A disgrace!SIGNIFICANT TWEETS AND NEWS:WINNING! U.S. Beats Singapore & Hong Kong To Become The World's Most Competitive Economy Again - #MAGA!Roseanne Barr is off TV but Samantha Bee is still on -- just another example of the media’s double standardThis timeline is unexpected. In 2018, I have already skipped a Star Wars movie in the theatres and paid money for a Kanye West Album.THE MADMAN-Probably the best quote in human history to date🐸 TOP SPICE OF THE DAY 🐸:"oh they're so good, oh they're so sweet."Today is Trump's 500th day as POTUS so here is a commemorative $500 bill.This triggers leftists.FITTON: My first official meme for the TD"Cuz we hate him"Monday, June 4th:TODAY'S ACTION:Vice President Pence Delivers Remarks at a Reception Promoting a Hemisphere of FreedomPresident Donald J. Trump Announces Intent to Nominate Personnel to a Key Administration PostPresidential Memorandum for the Secretary of StatePresidential Memorandum for the Secretary of StateEight Nominations Sent to the Senate Today🔥🔥TRUMP TWEETS🔥🔥:This is my 500th. Day in Office and we have accomplished a lot - many believe more than any President in his first 500 days. Massive Tax & Regulation Cuts, Military & Vets, Lower Crime & Illegal Immigration, Stronger Borders, Judgeships, Best Economy & Jobs EVER, and much more... ....We had Repeal & Replace done (and the saving to our country of one trillion dollars) except for one person, but it is getting done anyway. Individual Mandate is gone and great, less expensive plans will be announced this month. Drug prices coming down & Right to Try!“This is the best time EVER to look for a job.” James Freeman of WSJ.As has been stated by numerous legal scholars, I have the absolute right to PARDON myself, but why would I do that when I have done nothing wrong? In the meantime, the never ending Witch Hunt, led by 13 very Angry and Conflicted Democrats (& others) continues into the mid-terms!China already charges a tax of 16% on soybeans. Canada has all sorts of trade barriers on our Agricultural products. Not acceptable!The U.S. has made such bad trade deals over so many years that we can only WIN!Farmers have not been doing well for 15 years. Mexico, Canada, China and others have treated them unfairly. By the time I finish trade talks, that will change. Big trade barriers against U.S. farmers, and other businesses, will finally be broken. Massive trade deficits no longer!The appointment of the Special Counsel is totally UNCONSTITUTIONAL! Despite that, we play the game because I, unlike the Democrats, have done nothing wrong!#500Days of American Greatness: http://45.wh.gov/gNWs8uThe Fake News Media is desperate to distract from the economy and record setting economic numbers and so they keep talking about the phony Russian Witch Hunt.In many ways this is the greatest economy in the HISTORY of America and the best time EVER to look for a job!Big Supreme Court ruling for Baker just out!The Philadelphia Eagles Football Team was invited to the White House. Unfortunately, only a small number of players decided to come, and we canceled the event. Staying in the Locker Room for the playing of our National Anthem is as disrespectful to our country as kneeling. Sorry!SIGNIFICANT TWEETS AND NEWS:Supreme Court rules 7-2 in favor of Colorado baker who refused to bake a wedding cake for a gay couple on religious grounds. SCOTUS finds that the Colorado Civil Rights Commission did not consider this case with religious neutrality and violated the Free Exercise Clause.Stand for the Anthem or don’t come. I love this President.Watch Bernie Sanders Run From Alex Jones At LAX Airport29 Years ago Today. This is Communism. Never Forget.The media was all about an outgoing Obama pardoning Incoming Hillary. Then they were cool with Hillary pardoning herself. But now, because it’s DJT, now it’s a “constitutional crisis.” Sorry ass complicit jerk-offs.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:worst boycott ever #MAGAJust saw this on another sub. Pretty accurate tbhThis is America.BREAKING: In a narrow 2,623-487 county decision, Trump wins the US electionBREAKING: In narrow 77-0 decision, Oklahoma goes entirely Republican.Tuesday, June 5th:TODAY'S ACTION:President Trump Participates in the Celebration of AmericaHerschel Walker at the White House Sports and Fitness DayNatalie Gulbis at the White House Sports and Fitness DayPresident Trump Participates in the Signing Ceremony for S. 292🔥🔥TRUMP TWEETS🔥🔥:What is taking so long with the Inspector General’s Report on Crooked Hillary and Slippery James Comey. Numerous delays. Hope Report is not being changed and made weaker! There are so many horrible things to tell, the public has the right to know. Transparency!The U.S. has an increased economic value of more than 7 Trillion Dollars since the Election. May be the best economy in the history of our country. Record Jobs numbers. Nice!We will proudly be playing the National Anthem and other wonderful music celebrating our Country today at 3 P.M., The White House, with the United States Marine Band and the United States Army Chorus. Honoring America! NFL, no escaping to Locker Rooms!We have had many Championship teams recently at the White House including the Chicago Cubs, Houston Astros, Pittsburgh Penguins, New England Patriots, Alabama and Clemson National Champions, and many others. National Anthem & more great music today at 3:00 P.M.The Russian Witch Hunt Hoax continues, all because Jeff Sessions didn’t tell me he was going to recuse himself...I would have quickly picked someone else. So much time and money wasted, so many lives ruined...and Sessions knew better than most that there was No Collusion!Meeting in Singapore with North Korea will hopefully be the start of something big...we will soon [email protected] and Champion @MartinTruex_Jr were recently at the White House. It was a great day for a great sport!Separating families at the Border is the fault of bad legislation passed by the Democrats. Border Security laws should be changed but the Dems can’t get their act together! Started the Wall.In High Tax, High Crime California, be sure to get out and vote for Republican John Cox for Governor. He will make a BIG difference!Get the vote out in California today for Rep. Kevin McCarthy and all of the great GOP candidates for Congress. Keep our country out of the hands of High Tax, High Crime Nancy Pelosi.Vote for Congressman Devin Nunes, a true American Patriot the likes of which we rarely see in our modern day world....he truly loves our country and deserves everyone’s support!Senator @RogerWicker of Mississippi has done everything necessary to Make America Great Again! Get out and vote for Roger, he has my total support!Terrific new book out by the wonderful Harris Faulkner, “9 Rules of Engagement.” Harris shares lessons from a military family. Enjoy!The HISTORIC Rescissions Package we’ve proposed would cut $15,000,000,000 in Wasteful Spending! We are getting our government back on track.Imagine how much wasteful spending we’d save if we didn’t have Chuck and Nancy standing in our way! For years, Democrats in Congress have depleted our military and busted our budgets on needless spending, and to what end? No more.Wow, Strzok-Page, the incompetent & corrupt FBI lovers, have texts referring to a counter-intelligence operation into the Trump Campaign dating way back to December, 2015. SPYGATE is in full force! Is the Mainstream Media interested yet? Big stuff!(Retweeting Robby Starbuck) Fox News has been #1 for 197 months straight. In the latest ratings disaster for CNN they lost another 25% of their viewers. Fox has 10 of the top 15 shows and even hold the #1 spot in the younger key demo. The public is loudly rejecting @CNN.(Retweeting Eric Trump) #MakeAmericaGreatAgain 🇺🇸🇺🇸🇺🇸(Retweeting Brad Parscale) Since the #FakeNews is full of distortions, underreporting, and lies, we launched a platform tonight presenting a comprehensive record of @realDonaldTrump’s administration. The truth will be told about a remarkable 500-day record of accomplishments!Great interview by @LouDobbs with Chris Farrell of Judicial Watch concerning the governments counter-intelligence operation into the Trump Campaign. SPYGATE at the highest level. Who would believe? 10,534 replies 12,776 retweets 50,227 likesChris Farrell, Judicial Watch. “They were running an operation to undermine a candidate for President of the U.S. These are all violations of law. This is intelligence tradecraft to steer an election. There’s nothing more grave when it comes to abuse of our intelligence system... ... ...This is a level of criminality beyond the pale. This is such a grave abuse of power and authority, it’s like nothing else we’ve seen in our history. This makes the Nixon Watergate burglary look like keystone cop stuff....The greatest Witch Hunt in political history!Mitch McConnell announced he will cancel the Senate’s August Recess. Great, maybe the Democrats will finally get something done other than their acceptance of High Crime and High Taxes. We need Border Security!SIGNIFICANT TWEETS AND NEWS:For the first time in recorded American history the U.S. Department of Labor reports: Job openings exceed number of job seekers. (That.... Mr Obama is a fucking magic wand)TRUMP ON MIDTERMS: WE CANNOT BE COMPLACENT. GET OUT AND VOTE AL, IA, MS, MT, NJ, NM & SD!!Page/Strokz emails including the changing of the verbiage to exhonerate ClintonAndrew McCabe seeks immunity for testimony in congressional hearingTHIS IS YUUUUUUGE:U.S. Senate Majority Leader Mitch McConnell canceled the Senate's traditional August recess, citing Democrats' "historic obstruction" to pass legislation.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:The Blue Wave. Proof. It's Happening. The Democrats are "unstoppable".Different kids of diets😂 This past weekend #Antifa came out to play in the Pacific Northwest and did they ever get a surprise!GeniusDon't let the world forget KateTfw the OIG is taking so long with the report on Crooked Hillary and Slippery James ComeyWednesday, June 6th:TODAY'S ACTION:President Trump Participates in the Signing Ceremony for S. 2372 – VA Mission Act of 2018President Trump Signs VA Mission Act of 2018 into LawPresident Trump and Vice President Pence Attend the 2018 Hurricane Briefing at FEMA HQPresident Trump Delivers Remarks After the 2018 Hurricane Briefing at FEMA HQPresident Trump Hosts the White House IFTARPresident Donald J. Trump Announces Intent to Nominate and Appoint Personnel to Key Administration PostsPresident Donald J. Trump Announces Appointments for the Executive Office of the President🔥🔥TRUMP TWEETS🔥🔥:Great night for Republicans! Congratulations to John Cox on a really big number in California. He can win. Even Fake News CNN said the Trump impact was really big, much bigger than they ever thought possible. So much for the big Blue Wave, it may be a big Red Wave. Working hard!Gold Star father, Ceejay Metcalf, whose great son Michael was just honored at the White House, was fantastic this morning on @foxandfriends. He is a special man!The Fake News Media has been so unfair, and vicious, to my wife and our great First Lady, Melania. During her recovery from surgery they reported everything from near death, to facelift, to left the W.H. (and me) for N.Y. or Virginia, to abuse. All Fake, she is doing really well!...Four reporters spotted Melania in the White House last week walking merrily along to a meeting. They never reported the sighting because it would hurt the sick narrative that she was living in a different part of the world, was really ill, or whatever. Fake News is really bad!Many more Republican voters showed up yesterday than the Fake News thought possible. The political pundits just don’t get what is going on out there - or they do get it but refuse to report the facts! Remember, Dems are High Tax, High Crime, easy to beat!Congratulations to Dana Rohrabacher on his big California win. We are proud of you Dana!Today we mark another milestone: the 74th anniversary of #DDay, the Allied invasion of Normandy. On June 6, 1944, more than 70,000 brave young Americans charged out of landing craft, jumped out of airplanes, and stormed into hell...We must always protect those who protect us. Today, it was my great honor to sign the #VAMissionAct and to make Veterans Choice the permanent law of the land! http://45.wh.gov/dyWJNqThank you to everyone at @FEMA HQ for today’s briefing on preparations for the upcoming hurricane season. Disaster response and recovery is best achieved when it’s federally supported, state managed, and locally executed – this is the successful model we will continue to build.SIGNIFICANT TWEETS AND NEWS:Seventy-four years ago today American patriots fought and died by the thousands to stop real fascism, racial genocide, and oppression. Let's remember these brave Americans who gave it all so Soy Boys today can claim every patriotic American is a fascist and racist without a hint of irony. D-Day 44Steve Scalise back on the field today.BOMBSHELL REPORT: The Obama administration granted a license letting Iran access the United States financial system despite officials’ pledges that they would prohibit itPromisesKept.com President Donald J. Trump's AccomplishmentsHenry Winkler says he was among 118,000 voters 'left off' Los Angeles County rosters Fox NewsThe Most Ignored Bombshell of 2017: Samantha Power was caught using her security clearance as a UN ambassador to review private conversations by U.S. citizens 260 times in the 2016 election year... She said that someone else in the Obama White House did this, using her security clearance.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:This is AmericaThe most important comment I've ever made. If this message resonates with even one person then I will have made the world a better place.Commander of CheeseheadsMiss America crowned in advance! Judges cite her YUGE brains and charity work with mentally impaired media as key factors! Beautiful person!Thursday, June 7th:TODAY'S ACTION:They Said It Couldn't Be DonePresident Trumps Meets with the Prime Minister of JapanPresident Trump Hosts a Joint Press Conference with the Prime Minister of JapanPresident Trump Welcomes Prime Minister Shinzō Abe of Japan to the White House[]()🔥🔥TRUMP TWEETS🔥🔥:Isn’t it Ironic? Getting ready to go to the G-7 in Canada to fight for our country on Trade (we have the worst trade deals ever made), then off to Singapore to meet with North Korea & the Nuclear Problem...But back home we still have the 13 Angry Democrats pushing the Witch Hunt!Good luck to Alice Johnson. Have a wonderful life!Alan Dershowitz, Harvard Law Professor: “It all proves that we never needed a Special Counsel....All of this could have been done by the Justice Dept. Don’t need a multi-million dollar group of people with a target on someone’s back. Not the way Justice should operate.” So true!When and where will all of the many conflicts of interest be listed by the 13 Angry Democrats (plus) working on the Witch Hunt Hoax. There has never been a group of people on a case so biased or conflicted. It is all a Democrat Excuse for LOSING the Election. Where is the server?How could Jeff Flake, who is setting record low polling numbers in Arizona and was therefore humiliatingly forced out of his own Senate seat without even a fight (and who doesn’t have a clue), think about running for office, even a lower one, again? Let’s face it, he’s a Flake!Looking forward to seeing my friend Prime Minister @AbeShinzo of Japan at noon. Will be discussing North Korea and Trade.Our Justice Department must not let Awan & Debbie Wasserman Schultz off the hook. The Democrat I.T. scandal is a key to much of the corruption we see today. They want to make a “plea deal” to hide what is on their Server. Where is Server? Really bad!When will people start saying, “thank you, Mr. President, for firing James Comey?”The Obama Administration is now accused of trying to give Iran secret access to the financial system of the United States. This is totally illegal. Perhaps we could get the 13 Angry Democrats to divert some of their energy to this “matter” (as Comey would call it). Investigate!“Total jobless claims running at lowest level in 44 years”“$3 billion payoff: 101 utilities cut rates, credit GOP tax cuts”MAKING AMERICA GREAT AGAIN!It’s my great honor to welcome Prime Minister @AbeShinzo back to the @WhiteHouse!🇺🇸🇯🇵Today, I am greatly honored to welcome my good friend, PM Abe of Japan to the @WhiteHouse. Over the past 16 months the Prime Minister and I have worked closely together to address common challenges, of which there are many...PM Abe and I are also working to improve the trading relationship between the U.S. and Japan, something we have to do. The U.S. seeks a bilateral deal with Japan that is based on the principle of fairness and reciprocity. We’re working hard to reduce our trade imbalance...Great day of meetings with Prime Minister @AbeShinzo of Japan!Please tell Prime Minister Trudeau and President Macron that they are charging the U.S. massive tariffs and create non-monetary barriers. The EU trade surplus with the U.S. is $151 Billion, and Canada keeps our farmers and others out. Look forward to seeing them tomorrow.Prime Minister Trudeau is being so indignant, bringing up the relationship that the U.S. and Canada had over the many years and all sorts of other things...but he doesn’t bring up the fact that they charge us up to 300% on dairy — hurting our Farmers, killing our Agriculture!Why isn’t the European Union and Canada informing the public that for years they have used massive Trade Tariffs and non-monetary Trade Barriers against the U.S. Totally unfair to our farmers, workers & companies. Take down your tariffs & barriers or we will more than match you!SIGNIFICANT TWEETS AND NEWS:OUTRAGEOUS! New IG Report - Social Security Benefits paid to DACA! Illegals are receiving OUR Social Security Benefits!The Kent State 2A girl is a god-tier shitposter.MSNBC Calls Daughter Of Pardoned Alice Johnson — She Can’t Stop Thanking TrumpTime Magazine honors Trump again!!! Beautiful cover. The left can’t meme.LOL! Sean Hannity is trending on Twitter because he jokingly told "witnesses" to smash their phones with hammers before handing them over to Mueller. Stupid Liberals are saying he is tampering with evidence. They probably dont know thats what Hillary actually did.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:This is AmericaGrandfather was born a slave, mother was born a refugee, I was born freeThere are only 2 genders, and if you disagree then you're an Islamophobe. Leftist SJWs BTFO!Mirror, Mirror on THE WALL, who's the WOKEST of us ALL??Friday, June 8th:TODAY'S ACTION:President Donald J. Trump Proclaims June 14, 2018 as Flag Day and the Week Starting June 10, 2018 as National Flag WeekPresident Trump Delivers a Statement Upon DeparturePresident Trump Participates in an Expanded Bilateral Meeting with the Prime Minister of CanadaPresident Trump Participates in a Bilateral Meeting with the President of the French Republic🔥🔥TRUMP TWEETS🔥🔥:Obama, Schumer and Pelosi did NOTHING about North Korea, and now weak on Crime, High Tax Schumer is telling me what to do at the Summit the Dems could never set up. Schumer failed with North Korea and Iran, we don’t need his advice!Canada charges the U.S. a 270% tariff on Dairy Products! They didn’t tell you that, did they? Not fair to our farmers!Looking forward to straightening out unfair Trade Deals with the G-7 countries. If it doesn’t happen, we come out even better!Congratulations to the Washington Capitals on their GREAT play and winning the Stanley Cup Championship. Alex Ovechkin, the team captain, was spectacular - a true Superstar! D.C. is popping, in many ways. What a time!I am heading for Canada and the G-7 for talks that will mostly center on the long time unfair trade practiced against the United States. From there I go to Singapore and talks with North Korea on Denuclearization. Won’t be talking about the Russian Witch Hunt Hoax for a while!My thoughts and prayers are with the families of our serviceman who was killed and his fellow servicemen who were wounded in Somalia. They are truly all HEROES.(Retweeting G7 Canada) Day 1 of #G7Charlevoix in 60 seconds.SIGNIFICANT TWEETS AND NEWS:President Trump confirms intent to sign states' rights cannabis bill that was introduced in Congress yesterdayPewdiepie reuploads video exposing CNN and Hillary Clinton after it got copystriked and deleted!BAHAHAHAHAHA.............BAHAJSJSKGLGOGICSteam refuses to bend the knee to SJWs, choosing to stand with community - All content that is legal will be allowed.BREAKING: Trump tells kneeling NFL players to recommend people to pardon, since that's what they're supposedly protesting. Their reason to kneel just died. LOL🐸 TOP SPICE OF THE DAY 🐸:When you're surrounded by globalistsPresstitutesHookers for Hillary, I should have known...ARCHIVE: "Sleeping with your source- especially a vindictive congressman?" - Ali Watkins, 2013Saturday, June 10th:TODAY'S ACTION:President Trump delivers a statementSIGNIFICANT TWEETS AND NEWS:Ali Watkins not getting the probe she had hoped for; Feds have seized her email and phone records for investigation on James Wolfe!HOLY SHIT Last night Bill Maher said what every lefitist truly thinks but might not say out loud: That he HOPES FOR A RECESSION to hurt President Trump. They'd rather see our country fail if it means Trump won't succeed. This is peak Trump derangement, folks. SAD!James Wolfe Leak Investigation: Journalists Insist on a Double Standard - Andrew McCarthyNew italian PM Conte on Facebook: Historic alliance, new friendship 🤝 - Can't get tired of all this winning, MAGA and MIGA!!! 🍝🍔BREAKING: Seth Rich's Brother's Attorneys Subpoena Twitter to Turn Over All Direct Messages from: Wikileaks, Julian Assange, KimDotCom, Cassandra Fairbanks, Gateway Pundit, etc🐸 TOP SPICE OF THE DAY 🐸:The God Emperor and his court JesterUSA and Canada 🇺🇲🇨🇦Not a drill: European Union banning memes (seriously).Dressed up for me best friend Melania.So Much Winning, STILL NOT TIRED OF IT!!As always, some tunes to get you jamming through this long list of winning;Ghost Town4th DimensionNo MistakesWatchWhat Would Meek do?MAGA ON PATRIOTS!Submitted June 09, 2018 at 11:48AM by Ivaginaryfriend https://www.reddit.com/The\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_Donald/comments/8ptnk6/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /The_DonaldSubmitted June 09, 2018 at 12:48PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pu2ln/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pun4d/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 06:13PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pwc8s/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 07:13PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pwpq2/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 08:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pxdfj/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 10:18PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pxu3a/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 11:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pydsj/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 12:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pynsafternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 02:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pz72afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 03:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pzfe1/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 06:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q02kv/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 08:43AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q0jrp/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 09:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q0s8t/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 10:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q1bf2/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 12:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q1y1t/afternoon\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q2m9o/afternoon\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 05:28PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q41fu/afternoon\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 06:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q4hwafternoon\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 08:23PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q57mj/afternoon\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 09:28PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q5lxs/afternoon\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 11:48PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q6hj6/afternoon\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 12:18AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q6o1m/afternoon\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 01:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q71kt/afternoon\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 02:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q7hym/afternoon\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 03:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q7sgi/afternoon\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 06:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q8lkv/afternoon\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\_your\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 08:23AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q93tt/afternoon\\\\\\\\\\\\_magathread\\\\\\\\\\\\_your\\\\\\\\\\\\_weekly\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 09:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q9iv4/afternoon\\\\\\\\\\\_magathread\\\\\\\\\\\_your\\\\\\\\\\\_weekly\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 10:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qa4xafternoon\\\\\\\\\\_magathread\\\\\\\\\\_your\\\\\\\\\\_weekly\\\\\\\\\\_presidential/?utm\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 12:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qavpx/afternoon\\\\\\\\\_magathread\\\\\\\\\_your\\\\\\\\\_weekly\\\\\\\\\_presidential/?utm\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qbjwj/afternoon\\\\\\\\_magathread\\\\\\\\_your\\\\\\\\_weekly\\\\\\\\_presidential/?utm\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 06:38PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qdrii/afternoon\\\\\\\_magathread\\\\\\\_your\\\\\\\_weekly\\\\\\\_presidential/?utm\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 08:23PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qehmo/afternoon\\\\\\_magathread\\\\\\_your\\\\\\_weekly\\\\\\_presidential/?utm\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 09:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qf511/afternoon\\\\\_magathread\\\\\_your\\\\\_weekly\\\\\_presidential/?utm\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 11:18PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qfobv/afternoon\\\\_magathread\\\\_your\\\\_weekly\\\\_presidential/?utm\\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 01:38AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qghk4/afternoon\\\_magathread\\\_your\\\_weekly\\\_presidential/?utm\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 02:38AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qgspl/afternoon\\_magathread\\_your\\_weekly\\_presidential/?utm\\_source=iftttvia /MagaFirstNews
Submitted June 12, 2018 at 07:03AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qi1pi/afternoon\_magathread\_your\_weekly\_presidential/?utm\_source=ifttt
via /MagaFirstNews
submitted by peterboykin to MagaFirstNews [link] [comments]


2018.06.12 13:03 peterboykin Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!

Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!
Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!HAPPPPPPY SATURDAY, PATRIOTS!This is your girl u/IvaginaryFriend back at it again with a weeks worth of spice for you lovely Deplorables! (◠‿◠✿)Before we officially get this recap started, if you happened to miss any past recaps you can catch them here!Also, don't forget about our Header contest coming up on Monday, June 11th!!! The winning submission will be proudly presented at the top of the DOM for the next few months!!!Now, let's get on with the show!Sunday, June 3rd:🔥🔥TRUMP TWEETS🔥🔥:Jesse Watters “The only thing Trump obstructed was Hillary getting to the White House.” So true!As only one of two people left who could become President, why wouldn’t the FBI or Department of “Justice” have told me that they were secretly investigating Paul Manafort (on charges that were 10 years old and had been previously dropped) during my campaign? Should have told me!....Paul Manafort came into the campaign very late and was with us for a short period of time (he represented Ronald Reagan, Bob Dole & many others over the years), but we should have been told that Comey and the boys were doing a number on him, and he wouldn’t have been hired!Mark Penn “Why are there people from the Clinton Foundation on the Mueller Staff? Why is there an Independent Counsel? To go after people and their families for unrelated offenses...Constitution was set up to prevent this...Stormtrooper tactics almost.” A disgrace!SIGNIFICANT TWEETS AND NEWS:WINNING! U.S. Beats Singapore & Hong Kong To Become The World's Most Competitive Economy Again - #MAGA!Roseanne Barr is off TV but Samantha Bee is still on -- just another example of the media’s double standardThis timeline is unexpected. In 2018, I have already skipped a Star Wars movie in the theatres and paid money for a Kanye West Album.THE MADMAN-Probably the best quote in human history to date🐸 TOP SPICE OF THE DAY 🐸:"oh they're so good, oh they're so sweet."Today is Trump's 500th day as POTUS so here is a commemorative $500 bill.This triggers leftists.FITTON: My first official meme for the TD"Cuz we hate him"Monday, June 4th:TODAY'S ACTION:Vice President Pence Delivers Remarks at a Reception Promoting a Hemisphere of FreedomPresident Donald J. Trump Announces Intent to Nominate Personnel to a Key Administration PostPresidential Memorandum for the Secretary of StatePresidential Memorandum for the Secretary of StateEight Nominations Sent to the Senate Today🔥🔥TRUMP TWEETS🔥🔥:This is my 500th. Day in Office and we have accomplished a lot - many believe more than any President in his first 500 days. Massive Tax & Regulation Cuts, Military & Vets, Lower Crime & Illegal Immigration, Stronger Borders, Judgeships, Best Economy & Jobs EVER, and much more... ....We had Repeal & Replace done (and the saving to our country of one trillion dollars) except for one person, but it is getting done anyway. Individual Mandate is gone and great, less expensive plans will be announced this month. Drug prices coming down & Right to Try!“This is the best time EVER to look for a job.” James Freeman of WSJ.As has been stated by numerous legal scholars, I have the absolute right to PARDON myself, but why would I do that when I have done nothing wrong? In the meantime, the never ending Witch Hunt, led by 13 very Angry and Conflicted Democrats (& others) continues into the mid-terms!China already charges a tax of 16% on soybeans. Canada has all sorts of trade barriers on our Agricultural products. Not acceptable!The U.S. has made such bad trade deals over so many years that we can only WIN!Farmers have not been doing well for 15 years. Mexico, Canada, China and others have treated them unfairly. By the time I finish trade talks, that will change. Big trade barriers against U.S. farmers, and other businesses, will finally be broken. Massive trade deficits no longer!The appointment of the Special Counsel is totally UNCONSTITUTIONAL! Despite that, we play the game because I, unlike the Democrats, have done nothing wrong!#500Days of American Greatness: http://45.wh.gov/gNWs8uThe Fake News Media is desperate to distract from the economy and record setting economic numbers and so they keep talking about the phony Russian Witch Hunt.In many ways this is the greatest economy in the HISTORY of America and the best time EVER to look for a job!Big Supreme Court ruling for Baker just out!The Philadelphia Eagles Football Team was invited to the White House. Unfortunately, only a small number of players decided to come, and we canceled the event. Staying in the Locker Room for the playing of our National Anthem is as disrespectful to our country as kneeling. Sorry!SIGNIFICANT TWEETS AND NEWS:Supreme Court rules 7-2 in favor of Colorado baker who refused to bake a wedding cake for a gay couple on religious grounds. SCOTUS finds that the Colorado Civil Rights Commission did not consider this case with religious neutrality and violated the Free Exercise Clause.Stand for the Anthem or don’t come. I love this President.Watch Bernie Sanders Run From Alex Jones At LAX Airport29 Years ago Today. This is Communism. Never Forget.The media was all about an outgoing Obama pardoning Incoming Hillary. Then they were cool with Hillary pardoning herself. But now, because it’s DJT, now it’s a “constitutional crisis.” Sorry ass complicit jerk-offs.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:worst boycott ever #MAGAJust saw this on another sub. Pretty accurate tbhThis is America.BREAKING: In a narrow 2,623-487 county decision, Trump wins the US electionBREAKING: In narrow 77-0 decision, Oklahoma goes entirely Republican.Tuesday, June 5th:TODAY'S ACTION:President Trump Participates in the Celebration of AmericaHerschel Walker at the White House Sports and Fitness DayNatalie Gulbis at the White House Sports and Fitness DayPresident Trump Participates in the Signing Ceremony for S. 292🔥🔥TRUMP TWEETS🔥🔥:What is taking so long with the Inspector General’s Report on Crooked Hillary and Slippery James Comey. Numerous delays. Hope Report is not being changed and made weaker! There are so many horrible things to tell, the public has the right to know. Transparency!The U.S. has an increased economic value of more than 7 Trillion Dollars since the Election. May be the best economy in the history of our country. Record Jobs numbers. Nice!We will proudly be playing the National Anthem and other wonderful music celebrating our Country today at 3 P.M., The White House, with the United States Marine Band and the United States Army Chorus. Honoring America! NFL, no escaping to Locker Rooms!We have had many Championship teams recently at the White House including the Chicago Cubs, Houston Astros, Pittsburgh Penguins, New England Patriots, Alabama and Clemson National Champions, and many others. National Anthem & more great music today at 3:00 P.M.The Russian Witch Hunt Hoax continues, all because Jeff Sessions didn’t tell me he was going to recuse himself...I would have quickly picked someone else. So much time and money wasted, so many lives ruined...and Sessions knew better than most that there was No Collusion!Meeting in Singapore with North Korea will hopefully be the start of something big...we will soon [email protected] and Champion @MartinTruex_Jr were recently at the White House. It was a great day for a great sport!Separating families at the Border is the fault of bad legislation passed by the Democrats. Border Security laws should be changed but the Dems can’t get their act together! Started the Wall.In High Tax, High Crime California, be sure to get out and vote for Republican John Cox for Governor. He will make a BIG difference!Get the vote out in California today for Rep. Kevin McCarthy and all of the great GOP candidates for Congress. Keep our country out of the hands of High Tax, High Crime Nancy Pelosi.Vote for Congressman Devin Nunes, a true American Patriot the likes of which we rarely see in our modern day world....he truly loves our country and deserves everyone’s support!Senator @RogerWicker of Mississippi has done everything necessary to Make America Great Again! Get out and vote for Roger, he has my total support!Terrific new book out by the wonderful Harris Faulkner, “9 Rules of Engagement.” Harris shares lessons from a military family. Enjoy!The HISTORIC Rescissions Package we’ve proposed would cut $15,000,000,000 in Wasteful Spending! We are getting our government back on track.Imagine how much wasteful spending we’d save if we didn’t have Chuck and Nancy standing in our way! For years, Democrats in Congress have depleted our military and busted our budgets on needless spending, and to what end? No more.Wow, Strzok-Page, the incompetent & corrupt FBI lovers, have texts referring to a counter-intelligence operation into the Trump Campaign dating way back to December, 2015. SPYGATE is in full force! Is the Mainstream Media interested yet? Big stuff!(Retweeting Robby Starbuck) Fox News has been #1 for 197 months straight. In the latest ratings disaster for CNN they lost another 25% of their viewers. Fox has 10 of the top 15 shows and even hold the #1 spot in the younger key demo. The public is loudly rejecting @CNN.(Retweeting Eric Trump) #MakeAmericaGreatAgain 🇺🇸🇺🇸🇺🇸(Retweeting Brad Parscale) Since the #FakeNews is full of distortions, underreporting, and lies, we launched a platform tonight presenting a comprehensive record of @realDonaldTrump’s administration. The truth will be told about a remarkable 500-day record of accomplishments!Great interview by @LouDobbs with Chris Farrell of Judicial Watch concerning the governments counter-intelligence operation into the Trump Campaign. SPYGATE at the highest level. Who would believe? 10,534 replies 12,776 retweets 50,227 likesChris Farrell, Judicial Watch. “They were running an operation to undermine a candidate for President of the U.S. These are all violations of law. This is intelligence tradecraft to steer an election. There’s nothing more grave when it comes to abuse of our intelligence system... ... ...This is a level of criminality beyond the pale. This is such a grave abuse of power and authority, it’s like nothing else we’ve seen in our history. This makes the Nixon Watergate burglary look like keystone cop stuff....The greatest Witch Hunt in political history!Mitch McConnell announced he will cancel the Senate’s August Recess. Great, maybe the Democrats will finally get something done other than their acceptance of High Crime and High Taxes. We need Border Security!SIGNIFICANT TWEETS AND NEWS:For the first time in recorded American history the U.S. Department of Labor reports: Job openings exceed number of job seekers. (That.... Mr Obama is a fucking magic wand)TRUMP ON MIDTERMS: WE CANNOT BE COMPLACENT. GET OUT AND VOTE AL, IA, MS, MT, NJ, NM & SD!!Page/Strokz emails including the changing of the verbiage to exhonerate ClintonAndrew McCabe seeks immunity for testimony in congressional hearingTHIS IS YUUUUUUGE:U.S. Senate Majority Leader Mitch McConnell canceled the Senate's traditional August recess, citing Democrats' "historic obstruction" to pass legislation.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:The Blue Wave. Proof. It's Happening. The Democrats are "unstoppable".Different kids of diets😂 This past weekend #Antifa came out to play in the Pacific Northwest and did they ever get a surprise!GeniusDon't let the world forget KateTfw the OIG is taking so long with the report on Crooked Hillary and Slippery James ComeyWednesday, June 6th:TODAY'S ACTION:President Trump Participates in the Signing Ceremony for S. 2372 – VA Mission Act of 2018President Trump Signs VA Mission Act of 2018 into LawPresident Trump and Vice President Pence Attend the 2018 Hurricane Briefing at FEMA HQPresident Trump Delivers Remarks After the 2018 Hurricane Briefing at FEMA HQPresident Trump Hosts the White House IFTARPresident Donald J. Trump Announces Intent to Nominate and Appoint Personnel to Key Administration PostsPresident Donald J. Trump Announces Appointments for the Executive Office of the President🔥🔥TRUMP TWEETS🔥🔥:Great night for Republicans! Congratulations to John Cox on a really big number in California. He can win. Even Fake News CNN said the Trump impact was really big, much bigger than they ever thought possible. So much for the big Blue Wave, it may be a big Red Wave. Working hard!Gold Star father, Ceejay Metcalf, whose great son Michael was just honored at the White House, was fantastic this morning on @foxandfriends. He is a special man!The Fake News Media has been so unfair, and vicious, to my wife and our great First Lady, Melania. During her recovery from surgery they reported everything from near death, to facelift, to left the W.H. (and me) for N.Y. or Virginia, to abuse. All Fake, she is doing really well!...Four reporters spotted Melania in the White House last week walking merrily along to a meeting. They never reported the sighting because it would hurt the sick narrative that she was living in a different part of the world, was really ill, or whatever. Fake News is really bad!Many more Republican voters showed up yesterday than the Fake News thought possible. The political pundits just don’t get what is going on out there - or they do get it but refuse to report the facts! Remember, Dems are High Tax, High Crime, easy to beat!Congratulations to Dana Rohrabacher on his big California win. We are proud of you Dana!Today we mark another milestone: the 74th anniversary of #DDay, the Allied invasion of Normandy. On June 6, 1944, more than 70,000 brave young Americans charged out of landing craft, jumped out of airplanes, and stormed into hell...We must always protect those who protect us. Today, it was my great honor to sign the #VAMissionAct and to make Veterans Choice the permanent law of the land! http://45.wh.gov/dyWJNqThank you to everyone at @FEMA HQ for today’s briefing on preparations for the upcoming hurricane season. Disaster response and recovery is best achieved when it’s federally supported, state managed, and locally executed – this is the successful model we will continue to build.SIGNIFICANT TWEETS AND NEWS:Seventy-four years ago today American patriots fought and died by the thousands to stop real fascism, racial genocide, and oppression. Let's remember these brave Americans who gave it all so Soy Boys today can claim every patriotic American is a fascist and racist without a hint of irony. D-Day 44Steve Scalise back on the field today.BOMBSHELL REPORT: The Obama administration granted a license letting Iran access the United States financial system despite officials’ pledges that they would prohibit itPromisesKept.com President Donald J. Trump's AccomplishmentsHenry Winkler says he was among 118,000 voters 'left off' Los Angeles County rosters Fox NewsThe Most Ignored Bombshell of 2017: Samantha Power was caught using her security clearance as a UN ambassador to review private conversations by U.S. citizens 260 times in the 2016 election year... She said that someone else in the Obama White House did this, using her security clearance.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:This is AmericaThe most important comment I've ever made. If this message resonates with even one person then I will have made the world a better place.Commander of CheeseheadsMiss America crowned in advance! Judges cite her YUGE brains and charity work with mentally impaired media as key factors! Beautiful person!Thursday, June 7th:TODAY'S ACTION:They Said It Couldn't Be DonePresident Trumps Meets with the Prime Minister of JapanPresident Trump Hosts a Joint Press Conference with the Prime Minister of JapanPresident Trump Welcomes Prime Minister Shinzō Abe of Japan to the White House[]()🔥🔥TRUMP TWEETS🔥🔥:Isn’t it Ironic? Getting ready to go to the G-7 in Canada to fight for our country on Trade (we have the worst trade deals ever made), then off to Singapore to meet with North Korea & the Nuclear Problem...But back home we still have the 13 Angry Democrats pushing the Witch Hunt!Good luck to Alice Johnson. Have a wonderful life!Alan Dershowitz, Harvard Law Professor: “It all proves that we never needed a Special Counsel....All of this could have been done by the Justice Dept. Don’t need a multi-million dollar group of people with a target on someone’s back. Not the way Justice should operate.” So true!When and where will all of the many conflicts of interest be listed by the 13 Angry Democrats (plus) working on the Witch Hunt Hoax. There has never been a group of people on a case so biased or conflicted. It is all a Democrat Excuse for LOSING the Election. Where is the server?How could Jeff Flake, who is setting record low polling numbers in Arizona and was therefore humiliatingly forced out of his own Senate seat without even a fight (and who doesn’t have a clue), think about running for office, even a lower one, again? Let’s face it, he’s a Flake!Looking forward to seeing my friend Prime Minister @AbeShinzo of Japan at noon. Will be discussing North Korea and Trade.Our Justice Department must not let Awan & Debbie Wasserman Schultz off the hook. The Democrat I.T. scandal is a key to much of the corruption we see today. They want to make a “plea deal” to hide what is on their Server. Where is Server? Really bad!When will people start saying, “thank you, Mr. President, for firing James Comey?”The Obama Administration is now accused of trying to give Iran secret access to the financial system of the United States. This is totally illegal. Perhaps we could get the 13 Angry Democrats to divert some of their energy to this “matter” (as Comey would call it). Investigate!“Total jobless claims running at lowest level in 44 years”“$3 billion payoff: 101 utilities cut rates, credit GOP tax cuts”MAKING AMERICA GREAT AGAIN!It’s my great honor to welcome Prime Minister @AbeShinzo back to the @WhiteHouse!🇺🇸🇯🇵Today, I am greatly honored to welcome my good friend, PM Abe of Japan to the @WhiteHouse. Over the past 16 months the Prime Minister and I have worked closely together to address common challenges, of which there are many...PM Abe and I are also working to improve the trading relationship between the U.S. and Japan, something we have to do. The U.S. seeks a bilateral deal with Japan that is based on the principle of fairness and reciprocity. We’re working hard to reduce our trade imbalance...Great day of meetings with Prime Minister @AbeShinzo of Japan!Please tell Prime Minister Trudeau and President Macron that they are charging the U.S. massive tariffs and create non-monetary barriers. The EU trade surplus with the U.S. is $151 Billion, and Canada keeps our farmers and others out. Look forward to seeing them tomorrow.Prime Minister Trudeau is being so indignant, bringing up the relationship that the U.S. and Canada had over the many years and all sorts of other things...but he doesn’t bring up the fact that they charge us up to 300% on dairy — hurting our Farmers, killing our Agriculture!Why isn’t the European Union and Canada informing the public that for years they have used massive Trade Tariffs and non-monetary Trade Barriers against the U.S. Totally unfair to our farmers, workers & companies. Take down your tariffs & barriers or we will more than match you!SIGNIFICANT TWEETS AND NEWS:OUTRAGEOUS! New IG Report - Social Security Benefits paid to DACA! Illegals are receiving OUR Social Security Benefits!The Kent State 2A girl is a god-tier shitposter.MSNBC Calls Daughter Of Pardoned Alice Johnson — She Can’t Stop Thanking TrumpTime Magazine honors Trump again!!! Beautiful cover. The left can’t meme.LOL! Sean Hannity is trending on Twitter because he jokingly told "witnesses" to smash their phones with hammers before handing them over to Mueller. Stupid Liberals are saying he is tampering with evidence. They probably dont know thats what Hillary actually did.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:This is AmericaGrandfather was born a slave, mother was born a refugee, I was born freeThere are only 2 genders, and if you disagree then you're an Islamophobe. Leftist SJWs BTFO!Mirror, Mirror on THE WALL, who's the WOKEST of us ALL??Friday, June 8th:TODAY'S ACTION:President Donald J. Trump Proclaims June 14, 2018 as Flag Day and the Week Starting June 10, 2018 as National Flag WeekPresident Trump Delivers a Statement Upon DeparturePresident Trump Participates in an Expanded Bilateral Meeting with the Prime Minister of CanadaPresident Trump Participates in a Bilateral Meeting with the President of the French Republic🔥🔥TRUMP TWEETS🔥🔥:Obama, Schumer and Pelosi did NOTHING about North Korea, and now weak on Crime, High Tax Schumer is telling me what to do at the Summit the Dems could never set up. Schumer failed with North Korea and Iran, we don’t need his advice!Canada charges the U.S. a 270% tariff on Dairy Products! They didn’t tell you that, did they? Not fair to our farmers!Looking forward to straightening out unfair Trade Deals with the G-7 countries. If it doesn’t happen, we come out even better!Congratulations to the Washington Capitals on their GREAT play and winning the Stanley Cup Championship. Alex Ovechkin, the team captain, was spectacular - a true Superstar! D.C. is popping, in many ways. What a time!I am heading for Canada and the G-7 for talks that will mostly center on the long time unfair trade practiced against the United States. From there I go to Singapore and talks with North Korea on Denuclearization. Won’t be talking about the Russian Witch Hunt Hoax for a while!My thoughts and prayers are with the families of our serviceman who was killed and his fellow servicemen who were wounded in Somalia. They are truly all HEROES.(Retweeting G7 Canada) Day 1 of #G7Charlevoix in 60 seconds.SIGNIFICANT TWEETS AND NEWS:President Trump confirms intent to sign states' rights cannabis bill that was introduced in Congress yesterdayPewdiepie reuploads video exposing CNN and Hillary Clinton after it got copystriked and deleted!BAHAHAHAHAHA.............BAHAJSJSKGLGOGICSteam refuses to bend the knee to SJWs, choosing to stand with community - All content that is legal will be allowed.BREAKING: Trump tells kneeling NFL players to recommend people to pardon, since that's what they're supposedly protesting. Their reason to kneel just died. LOL🐸 TOP SPICE OF THE DAY 🐸:When you're surrounded by globalistsPresstitutesHookers for Hillary, I should have known...ARCHIVE: "Sleeping with your source- especially a vindictive congressman?" - Ali Watkins, 2013Saturday, June 10th:TODAY'S ACTION:President Trump delivers a statementSIGNIFICANT TWEETS AND NEWS:Ali Watkins not getting the probe she had hoped for; Feds have seized her email and phone records for investigation on James Wolfe!HOLY SHIT Last night Bill Maher said what every lefitist truly thinks but might not say out loud: That he HOPES FOR A RECESSION to hurt President Trump. They'd rather see our country fail if it means Trump won't succeed. This is peak Trump derangement, folks. SAD!James Wolfe Leak Investigation: Journalists Insist on a Double Standard - Andrew McCarthyNew italian PM Conte on Facebook: Historic alliance, new friendship 🤝 - Can't get tired of all this winning, MAGA and MIGA!!! 🍝🍔BREAKING: Seth Rich's Brother's Attorneys Subpoena Twitter to Turn Over All Direct Messages from: Wikileaks, Julian Assange, KimDotCom, Cassandra Fairbanks, Gateway Pundit, etc🐸 TOP SPICE OF THE DAY 🐸:The God Emperor and his court JesterUSA and Canada 🇺🇲🇨🇦Not a drill: European Union banning memes (seriously).Dressed up for me best friend Melania.So Much Winning, STILL NOT TIRED OF IT!!As always, some tunes to get you jamming through this long list of winning;Ghost Town4th DimensionNo MistakesWatchWhat Would Meek do?MAGA ON PATRIOTS!Submitted June 09, 2018 at 11:48AM by Ivaginaryfriend https://www.reddit.com/The\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_Donald/comments/8ptnk6/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /The_DonaldSubmitted June 09, 2018 at 12:48PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pu2ln/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pun4d/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 06:13PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pwc8s/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 07:13PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pwpq2/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 08:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pxdfj/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 10:18PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pxu3a/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 11:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pydsj/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 12:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pynsafternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 02:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pz72afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 03:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pzfe1/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 06:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q02kv/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 08:43AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q0jrp/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 09:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q0s8t/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 10:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q1bf2/afternoon\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 12:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q1y1t/afternoon\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q2m9o/afternoon\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 05:28PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q41fu/afternoon\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 06:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q4hwafternoon\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 08:23PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q57mj/afternoon\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 09:28PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q5lxs/afternoon\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 11:48PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q6hj6/afternoon\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 12:18AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q6o1m/afternoon\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 01:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q71kt/afternoon\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 02:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q7hym/afternoon\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 03:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q7sgi/afternoon\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\_your\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 06:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q8lkv/afternoon\\\\\\\\\\\\_magathread\\\\\\\\\\\\_your\\\\\\\\\\\\_weekly\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 08:23AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q93tt/afternoon\\\\\\\\\\\_magathread\\\\\\\\\\\_your\\\\\\\\\\\_weekly\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 09:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q9iv4/afternoon\\\\\\\\\\_magathread\\\\\\\\\\_your\\\\\\\\\\_weekly\\\\\\\\\\_presidential/?utm\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 10:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qa4xafternoon\\\\\\\\\_magathread\\\\\\\\\_your\\\\\\\\\_weekly\\\\\\\\\_presidential/?utm\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 12:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qavpx/afternoon\\\\\\\\_magathread\\\\\\\\_your\\\\\\\\_weekly\\\\\\\\_presidential/?utm\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qbjwj/afternoon\\\\\\\_magathread\\\\\\\_your\\\\\\\_weekly\\\\\\\_presidential/?utm\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 06:38PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qdrii/afternoon\\\\\\_magathread\\\\\\_your\\\\\\_weekly\\\\\\_presidential/?utm\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 08:23PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qehmo/afternoon\\\\\_magathread\\\\\_your\\\\\_weekly\\\\\_presidential/?utm\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 09:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qf511/afternoon\\\\_magathread\\\\_your\\\\_weekly\\\\_presidential/?utm\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 11:18PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qfobv/afternoon\\\_magathread\\\_your\\\_weekly\\\_presidential/?utm\\\_source=iftttvia /MagaFirstNewsSubmitted June 12, 2018 at 01:38AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qghk4/afternoon\\_magathread\\_your\\_weekly\\_presidential/?utm\\_source=iftttvia /MagaFirstNews
Submitted June 12, 2018 at 02:38AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qgspl/afternoon\_magathread\_your\_weekly\_presidential/?utm\_source=ifttt
via /MagaFirstNews
submitted by peterboykin to MagaFirstNews [link] [comments]


2018.06.12 08:38 peterboykin Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!

Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!
Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!HAPPPPPPY SATURDAY, PATRIOTS!This is your girl u/IvaginaryFriend back at it again with a weeks worth of spice for you lovely Deplorables! (◠‿◠✿)Before we officially get this recap started, if you happened to miss any past recaps you can catch them here!Also, don't forget about our Header contest coming up on Monday, June 11th!!! The winning submission will be proudly presented at the top of the DOM for the next few months!!!Now, let's get on with the show!Sunday, June 3rd:🔥🔥TRUMP TWEETS🔥🔥:Jesse Watters “The only thing Trump obstructed was Hillary getting to the White House.” So true!As only one of two people left who could become President, why wouldn’t the FBI or Department of “Justice” have told me that they were secretly investigating Paul Manafort (on charges that were 10 years old and had been previously dropped) during my campaign? Should have told me!....Paul Manafort came into the campaign very late and was with us for a short period of time (he represented Ronald Reagan, Bob Dole & many others over the years), but we should have been told that Comey and the boys were doing a number on him, and he wouldn’t have been hired!Mark Penn “Why are there people from the Clinton Foundation on the Mueller Staff? Why is there an Independent Counsel? To go after people and their families for unrelated offenses...Constitution was set up to prevent this...Stormtrooper tactics almost.” A disgrace!SIGNIFICANT TWEETS AND NEWS:WINNING! U.S. Beats Singapore & Hong Kong To Become The World's Most Competitive Economy Again - #MAGA!Roseanne Barr is off TV but Samantha Bee is still on -- just another example of the media’s double standardThis timeline is unexpected. In 2018, I have already skipped a Star Wars movie in the theatres and paid money for a Kanye West Album.THE MADMAN-Probably the best quote in human history to date🐸 TOP SPICE OF THE DAY 🐸:"oh they're so good, oh they're so sweet."Today is Trump's 500th day as POTUS so here is a commemorative $500 bill.This triggers leftists.FITTON: My first official meme for the TD"Cuz we hate him"Monday, June 4th:TODAY'S ACTION:Vice President Pence Delivers Remarks at a Reception Promoting a Hemisphere of FreedomPresident Donald J. Trump Announces Intent to Nominate Personnel to a Key Administration PostPresidential Memorandum for the Secretary of StatePresidential Memorandum for the Secretary of StateEight Nominations Sent to the Senate Today🔥🔥TRUMP TWEETS🔥🔥:This is my 500th. Day in Office and we have accomplished a lot - many believe more than any President in his first 500 days. Massive Tax & Regulation Cuts, Military & Vets, Lower Crime & Illegal Immigration, Stronger Borders, Judgeships, Best Economy & Jobs EVER, and much more... ....We had Repeal & Replace done (and the saving to our country of one trillion dollars) except for one person, but it is getting done anyway. Individual Mandate is gone and great, less expensive plans will be announced this month. Drug prices coming down & Right to Try!“This is the best time EVER to look for a job.” James Freeman of WSJ.As has been stated by numerous legal scholars, I have the absolute right to PARDON myself, but why would I do that when I have done nothing wrong? In the meantime, the never ending Witch Hunt, led by 13 very Angry and Conflicted Democrats (& others) continues into the mid-terms!China already charges a tax of 16% on soybeans. Canada has all sorts of trade barriers on our Agricultural products. Not acceptable!The U.S. has made such bad trade deals over so many years that we can only WIN!Farmers have not been doing well for 15 years. Mexico, Canada, China and others have treated them unfairly. By the time I finish trade talks, that will change. Big trade barriers against U.S. farmers, and other businesses, will finally be broken. Massive trade deficits no longer!The appointment of the Special Counsel is totally UNCONSTITUTIONAL! Despite that, we play the game because I, unlike the Democrats, have done nothing wrong!#500Days of American Greatness: http://45.wh.gov/gNWs8uThe Fake News Media is desperate to distract from the economy and record setting economic numbers and so they keep talking about the phony Russian Witch Hunt.In many ways this is the greatest economy in the HISTORY of America and the best time EVER to look for a job!Big Supreme Court ruling for Baker just out!The Philadelphia Eagles Football Team was invited to the White House. Unfortunately, only a small number of players decided to come, and we canceled the event. Staying in the Locker Room for the playing of our National Anthem is as disrespectful to our country as kneeling. Sorry!SIGNIFICANT TWEETS AND NEWS:Supreme Court rules 7-2 in favor of Colorado baker who refused to bake a wedding cake for a gay couple on religious grounds. SCOTUS finds that the Colorado Civil Rights Commission did not consider this case with religious neutrality and violated the Free Exercise Clause.Stand for the Anthem or don’t come. I love this President.Watch Bernie Sanders Run From Alex Jones At LAX Airport29 Years ago Today. This is Communism. Never Forget.The media was all about an outgoing Obama pardoning Incoming Hillary. Then they were cool with Hillary pardoning herself. But now, because it’s DJT, now it’s a “constitutional crisis.” Sorry ass complicit jerk-offs.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:worst boycott ever #MAGAJust saw this on another sub. Pretty accurate tbhThis is America.BREAKING: In a narrow 2,623-487 county decision, Trump wins the US electionBREAKING: In narrow 77-0 decision, Oklahoma goes entirely Republican.Tuesday, June 5th:TODAY'S ACTION:President Trump Participates in the Celebration of AmericaHerschel Walker at the White House Sports and Fitness DayNatalie Gulbis at the White House Sports and Fitness DayPresident Trump Participates in the Signing Ceremony for S. 292🔥🔥TRUMP TWEETS🔥🔥:What is taking so long with the Inspector General’s Report on Crooked Hillary and Slippery James Comey. Numerous delays. Hope Report is not being changed and made weaker! There are so many horrible things to tell, the public has the right to know. Transparency!The U.S. has an increased economic value of more than 7 Trillion Dollars since the Election. May be the best economy in the history of our country. Record Jobs numbers. Nice!We will proudly be playing the National Anthem and other wonderful music celebrating our Country today at 3 P.M., The White House, with the United States Marine Band and the United States Army Chorus. Honoring America! NFL, no escaping to Locker Rooms!We have had many Championship teams recently at the White House including the Chicago Cubs, Houston Astros, Pittsburgh Penguins, New England Patriots, Alabama and Clemson National Champions, and many others. National Anthem & more great music today at 3:00 P.M.The Russian Witch Hunt Hoax continues, all because Jeff Sessions didn’t tell me he was going to recuse himself...I would have quickly picked someone else. So much time and money wasted, so many lives ruined...and Sessions knew better than most that there was No Collusion!Meeting in Singapore with North Korea will hopefully be the start of something big...we will soon [email protected] and Champion @MartinTruex_Jr were recently at the White House. It was a great day for a great sport!Separating families at the Border is the fault of bad legislation passed by the Democrats. Border Security laws should be changed but the Dems can’t get their act together! Started the Wall.In High Tax, High Crime California, be sure to get out and vote for Republican John Cox for Governor. He will make a BIG difference!Get the vote out in California today for Rep. Kevin McCarthy and all of the great GOP candidates for Congress. Keep our country out of the hands of High Tax, High Crime Nancy Pelosi.Vote for Congressman Devin Nunes, a true American Patriot the likes of which we rarely see in our modern day world....he truly loves our country and deserves everyone’s support!Senator @RogerWicker of Mississippi has done everything necessary to Make America Great Again! Get out and vote for Roger, he has my total support!Terrific new book out by the wonderful Harris Faulkner, “9 Rules of Engagement.” Harris shares lessons from a military family. Enjoy!The HISTORIC Rescissions Package we’ve proposed would cut $15,000,000,000 in Wasteful Spending! We are getting our government back on track.Imagine how much wasteful spending we’d save if we didn’t have Chuck and Nancy standing in our way! For years, Democrats in Congress have depleted our military and busted our budgets on needless spending, and to what end? No more.Wow, Strzok-Page, the incompetent & corrupt FBI lovers, have texts referring to a counter-intelligence operation into the Trump Campaign dating way back to December, 2015. SPYGATE is in full force! Is the Mainstream Media interested yet? Big stuff!(Retweeting Robby Starbuck) Fox News has been #1 for 197 months straight. In the latest ratings disaster for CNN they lost another 25% of their viewers. Fox has 10 of the top 15 shows and even hold the #1 spot in the younger key demo. The public is loudly rejecting @CNN.(Retweeting Eric Trump) #MakeAmericaGreatAgain 🇺🇸🇺🇸🇺🇸(Retweeting Brad Parscale) Since the #FakeNews is full of distortions, underreporting, and lies, we launched a platform tonight presenting a comprehensive record of @realDonaldTrump’s administration. The truth will be told about a remarkable 500-day record of accomplishments!Great interview by @LouDobbs with Chris Farrell of Judicial Watch concerning the governments counter-intelligence operation into the Trump Campaign. SPYGATE at the highest level. Who would believe? 10,534 replies 12,776 retweets 50,227 likesChris Farrell, Judicial Watch. “They were running an operation to undermine a candidate for President of the U.S. These are all violations of law. This is intelligence tradecraft to steer an election. There’s nothing more grave when it comes to abuse of our intelligence system... ... ...This is a level of criminality beyond the pale. This is such a grave abuse of power and authority, it’s like nothing else we’ve seen in our history. This makes the Nixon Watergate burglary look like keystone cop stuff....The greatest Witch Hunt in political history!Mitch McConnell announced he will cancel the Senate’s August Recess. Great, maybe the Democrats will finally get something done other than their acceptance of High Crime and High Taxes. We need Border Security!SIGNIFICANT TWEETS AND NEWS:For the first time in recorded American history the U.S. Department of Labor reports: Job openings exceed number of job seekers. (That.... Mr Obama is a fucking magic wand)TRUMP ON MIDTERMS: WE CANNOT BE COMPLACENT. GET OUT AND VOTE AL, IA, MS, MT, NJ, NM & SD!!Page/Strokz emails including the changing of the verbiage to exhonerate ClintonAndrew McCabe seeks immunity for testimony in congressional hearingTHIS IS YUUUUUUGE:U.S. Senate Majority Leader Mitch McConnell canceled the Senate's traditional August recess, citing Democrats' "historic obstruction" to pass legislation.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:The Blue Wave. Proof. It's Happening. The Democrats are "unstoppable".Different kids of diets😂 This past weekend #Antifa came out to play in the Pacific Northwest and did they ever get a surprise!GeniusDon't let the world forget KateTfw the OIG is taking so long with the report on Crooked Hillary and Slippery James ComeyWednesday, June 6th:TODAY'S ACTION:President Trump Participates in the Signing Ceremony for S. 2372 – VA Mission Act of 2018President Trump Signs VA Mission Act of 2018 into LawPresident Trump and Vice President Pence Attend the 2018 Hurricane Briefing at FEMA HQPresident Trump Delivers Remarks After the 2018 Hurricane Briefing at FEMA HQPresident Trump Hosts the White House IFTARPresident Donald J. Trump Announces Intent to Nominate and Appoint Personnel to Key Administration PostsPresident Donald J. Trump Announces Appointments for the Executive Office of the President🔥🔥TRUMP TWEETS🔥🔥:Great night for Republicans! Congratulations to John Cox on a really big number in California. He can win. Even Fake News CNN said the Trump impact was really big, much bigger than they ever thought possible. So much for the big Blue Wave, it may be a big Red Wave. Working hard!Gold Star father, Ceejay Metcalf, whose great son Michael was just honored at the White House, was fantastic this morning on @foxandfriends. He is a special man!The Fake News Media has been so unfair, and vicious, to my wife and our great First Lady, Melania. During her recovery from surgery they reported everything from near death, to facelift, to left the W.H. (and me) for N.Y. or Virginia, to abuse. All Fake, she is doing really well!...Four reporters spotted Melania in the White House last week walking merrily along to a meeting. They never reported the sighting because it would hurt the sick narrative that she was living in a different part of the world, was really ill, or whatever. Fake News is really bad!Many more Republican voters showed up yesterday than the Fake News thought possible. The political pundits just don’t get what is going on out there - or they do get it but refuse to report the facts! Remember, Dems are High Tax, High Crime, easy to beat!Congratulations to Dana Rohrabacher on his big California win. We are proud of you Dana!Today we mark another milestone: the 74th anniversary of #DDay, the Allied invasion of Normandy. On June 6, 1944, more than 70,000 brave young Americans charged out of landing craft, jumped out of airplanes, and stormed into hell...We must always protect those who protect us. Today, it was my great honor to sign the #VAMissionAct and to make Veterans Choice the permanent law of the land! http://45.wh.gov/dyWJNqThank you to everyone at @FEMA HQ for today’s briefing on preparations for the upcoming hurricane season. Disaster response and recovery is best achieved when it’s federally supported, state managed, and locally executed – this is the successful model we will continue to build.SIGNIFICANT TWEETS AND NEWS:Seventy-four years ago today American patriots fought and died by the thousands to stop real fascism, racial genocide, and oppression. Let's remember these brave Americans who gave it all so Soy Boys today can claim every patriotic American is a fascist and racist without a hint of irony. D-Day 44Steve Scalise back on the field today.BOMBSHELL REPORT: The Obama administration granted a license letting Iran access the United States financial system despite officials’ pledges that they would prohibit itPromisesKept.com President Donald J. Trump's AccomplishmentsHenry Winkler says he was among 118,000 voters 'left off' Los Angeles County rosters Fox NewsThe Most Ignored Bombshell of 2017: Samantha Power was caught using her security clearance as a UN ambassador to review private conversations by U.S. citizens 260 times in the 2016 election year... She said that someone else in the Obama White House did this, using her security clearance.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:This is AmericaThe most important comment I've ever made. If this message resonates with even one person then I will have made the world a better place.Commander of CheeseheadsMiss America crowned in advance! Judges cite her YUGE brains and charity work with mentally impaired media as key factors! Beautiful person!Thursday, June 7th:TODAY'S ACTION:They Said It Couldn't Be DonePresident Trumps Meets with the Prime Minister of JapanPresident Trump Hosts a Joint Press Conference with the Prime Minister of JapanPresident Trump Welcomes Prime Minister Shinzō Abe of Japan to the White House[]()🔥🔥TRUMP TWEETS🔥🔥:Isn’t it Ironic? Getting ready to go to the G-7 in Canada to fight for our country on Trade (we have the worst trade deals ever made), then off to Singapore to meet with North Korea & the Nuclear Problem...But back home we still have the 13 Angry Democrats pushing the Witch Hunt!Good luck to Alice Johnson. Have a wonderful life!Alan Dershowitz, Harvard Law Professor: “It all proves that we never needed a Special Counsel....All of this could have been done by the Justice Dept. Don’t need a multi-million dollar group of people with a target on someone’s back. Not the way Justice should operate.” So true!When and where will all of the many conflicts of interest be listed by the 13 Angry Democrats (plus) working on the Witch Hunt Hoax. There has never been a group of people on a case so biased or conflicted. It is all a Democrat Excuse for LOSING the Election. Where is the server?How could Jeff Flake, who is setting record low polling numbers in Arizona and was therefore humiliatingly forced out of his own Senate seat without even a fight (and who doesn’t have a clue), think about running for office, even a lower one, again? Let’s face it, he’s a Flake!Looking forward to seeing my friend Prime Minister @AbeShinzo of Japan at noon. Will be discussing North Korea and Trade.Our Justice Department must not let Awan & Debbie Wasserman Schultz off the hook. The Democrat I.T. scandal is a key to much of the corruption we see today. They want to make a “plea deal” to hide what is on their Server. Where is Server? Really bad!When will people start saying, “thank you, Mr. President, for firing James Comey?”The Obama Administration is now accused of trying to give Iran secret access to the financial system of the United States. This is totally illegal. Perhaps we could get the 13 Angry Democrats to divert some of their energy to this “matter” (as Comey would call it). Investigate!“Total jobless claims running at lowest level in 44 years”“$3 billion payoff: 101 utilities cut rates, credit GOP tax cuts”MAKING AMERICA GREAT AGAIN!It’s my great honor to welcome Prime Minister @AbeShinzo back to the @WhiteHouse!🇺🇸🇯🇵Today, I am greatly honored to welcome my good friend, PM Abe of Japan to the @WhiteHouse. Over the past 16 months the Prime Minister and I have worked closely together to address common challenges, of which there are many...PM Abe and I are also working to improve the trading relationship between the U.S. and Japan, something we have to do. The U.S. seeks a bilateral deal with Japan that is based on the principle of fairness and reciprocity. We’re working hard to reduce our trade imbalance...Great day of meetings with Prime Minister @AbeShinzo of Japan!Please tell Prime Minister Trudeau and President Macron that they are charging the U.S. massive tariffs and create non-monetary barriers. The EU trade surplus with the U.S. is $151 Billion, and Canada keeps our farmers and others out. Look forward to seeing them tomorrow.Prime Minister Trudeau is being so indignant, bringing up the relationship that the U.S. and Canada had over the many years and all sorts of other things...but he doesn’t bring up the fact that they charge us up to 300% on dairy — hurting our Farmers, killing our Agriculture!Why isn’t the European Union and Canada informing the public that for years they have used massive Trade Tariffs and non-monetary Trade Barriers against the U.S. Totally unfair to our farmers, workers & companies. Take down your tariffs & barriers or we will more than match you!SIGNIFICANT TWEETS AND NEWS:OUTRAGEOUS! New IG Report - Social Security Benefits paid to DACA! Illegals are receiving OUR Social Security Benefits!The Kent State 2A girl is a god-tier shitposter.MSNBC Calls Daughter Of Pardoned Alice Johnson — She Can’t Stop Thanking TrumpTime Magazine honors Trump again!!! Beautiful cover. The left can’t meme.LOL! Sean Hannity is trending on Twitter because he jokingly told "witnesses" to smash their phones with hammers before handing them over to Mueller. Stupid Liberals are saying he is tampering with evidence. They probably dont know thats what Hillary actually did.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:This is AmericaGrandfather was born a slave, mother was born a refugee, I was born freeThere are only 2 genders, and if you disagree then you're an Islamophobe. Leftist SJWs BTFO!Mirror, Mirror on THE WALL, who's the WOKEST of us ALL??Friday, June 8th:TODAY'S ACTION:President Donald J. Trump Proclaims June 14, 2018 as Flag Day and the Week Starting June 10, 2018 as National Flag WeekPresident Trump Delivers a Statement Upon DeparturePresident Trump Participates in an Expanded Bilateral Meeting with the Prime Minister of CanadaPresident Trump Participates in a Bilateral Meeting with the President of the French Republic🔥🔥TRUMP TWEETS🔥🔥:Obama, Schumer and Pelosi did NOTHING about North Korea, and now weak on Crime, High Tax Schumer is telling me what to do at the Summit the Dems could never set up. Schumer failed with North Korea and Iran, we don’t need his advice!Canada charges the U.S. a 270% tariff on Dairy Products! They didn’t tell you that, did they? Not fair to our farmers!Looking forward to straightening out unfair Trade Deals with the G-7 countries. If it doesn’t happen, we come out even better!Congratulations to the Washington Capitals on their GREAT play and winning the Stanley Cup Championship. Alex Ovechkin, the team captain, was spectacular - a true Superstar! D.C. is popping, in many ways. What a time!I am heading for Canada and the G-7 for talks that will mostly center on the long time unfair trade practiced against the United States. From there I go to Singapore and talks with North Korea on Denuclearization. Won’t be talking about the Russian Witch Hunt Hoax for a while!My thoughts and prayers are with the families of our serviceman who was killed and his fellow servicemen who were wounded in Somalia. They are truly all HEROES.(Retweeting G7 Canada) Day 1 of #G7Charlevoix in 60 seconds.SIGNIFICANT TWEETS AND NEWS:President Trump confirms intent to sign states' rights cannabis bill that was introduced in Congress yesterdayPewdiepie reuploads video exposing CNN and Hillary Clinton after it got copystriked and deleted!BAHAHAHAHAHA.............BAHAJSJSKGLGOGICSteam refuses to bend the knee to SJWs, choosing to stand with community - All content that is legal will be allowed.BREAKING: Trump tells kneeling NFL players to recommend people to pardon, since that's what they're supposedly protesting. Their reason to kneel just died. LOL🐸 TOP SPICE OF THE DAY 🐸:When you're surrounded by globalistsPresstitutesHookers for Hillary, I should have known...ARCHIVE: "Sleeping with your source- especially a vindictive congressman?" - Ali Watkins, 2013Saturday, June 10th:TODAY'S ACTION:President Trump delivers a statementSIGNIFICANT TWEETS AND NEWS:Ali Watkins not getting the probe she had hoped for; Feds have seized her email and phone records for investigation on James Wolfe!HOLY SHIT Last night Bill Maher said what every lefitist truly thinks but might not say out loud: That he HOPES FOR A RECESSION to hurt President Trump. They'd rather see our country fail if it means Trump won't succeed. This is peak Trump derangement, folks. SAD!James Wolfe Leak Investigation: Journalists Insist on a Double Standard - Andrew McCarthyNew italian PM Conte on Facebook: Historic alliance, new friendship 🤝 - Can't get tired of all this winning, MAGA and MIGA!!! 🍝🍔BREAKING: Seth Rich's Brother's Attorneys Subpoena Twitter to Turn Over All Direct Messages from: Wikileaks, Julian Assange, KimDotCom, Cassandra Fairbanks, Gateway Pundit, etc🐸 TOP SPICE OF THE DAY 🐸:The God Emperor and his court JesterUSA and Canada 🇺🇲🇨🇦Not a drill: European Union banning memes (seriously).Dressed up for me best friend Melania.So Much Winning, STILL NOT TIRED OF IT!!As always, some tunes to get you jamming through this long list of winning;Ghost Town4th DimensionNo MistakesWatchWhat Would Meek do?MAGA ON PATRIOTS!Submitted June 09, 2018 at 11:48AM by Ivaginaryfriend https://www.reddit.com/The\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_Donald/comments/8ptnk6/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /The_DonaldSubmitted June 09, 2018 at 12:48PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pu2ln/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pun4d/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 06:13PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pwc8s/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 07:13PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pwpq2/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 08:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pxdfj/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 10:18PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pxu3a/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 11:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pydsj/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 12:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pynsafternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 02:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pz72afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 03:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pzfe1/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 06:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q02kv/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 08:43AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q0jrp/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 09:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q0s8t/afternoon\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 10:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q1bf2/afternoon\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 12:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q1y1t/afternoon\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q2m9o/afternoon\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 05:28PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q41fu/afternoon\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 06:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q4hwafternoon\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 08:23PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q57mj/afternoon\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 09:28PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q5lxs/afternoon\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 11:48PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q6hj6/afternoon\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 12:18AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q6o1m/afternoon\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 01:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q71kt/afternoon\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 02:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q7hym/afternoon\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\_your\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 03:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q7sgi/afternoon\\\\\\\\\\\\_magathread\\\\\\\\\\\\_your\\\\\\\\\\\\_weekly\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 06:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q8lkv/afternoon\\\\\\\\\\\_magathread\\\\\\\\\\\_your\\\\\\\\\\\_weekly\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 08:23AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q93tt/afternoon\\\\\\\\\\_magathread\\\\\\\\\\_your\\\\\\\\\\_weekly\\\\\\\\\\_presidential/?utm\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 09:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q9iv4/afternoon\\\\\\\\\_magathread\\\\\\\\\_your\\\\\\\\\_weekly\\\\\\\\\_presidential/?utm\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 10:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qa4xafternoon\\\\\\\\_magathread\\\\\\\\_your\\\\\\\\_weekly\\\\\\\\_presidential/?utm\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 12:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qavpx/afternoon\\\\\\\_magathread\\\\\\\_your\\\\\\\_weekly\\\\\\\_presidential/?utm\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qbjwj/afternoon\\\\\\_magathread\\\\\\_your\\\\\\_weekly\\\\\\_presidential/?utm\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 06:38PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qdrii/afternoon\\\\\_magathread\\\\\_your\\\\\_weekly\\\\\_presidential/?utm\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 08:23PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qehmo/afternoon\\\\_magathread\\\\_your\\\\_weekly\\\\_presidential/?utm\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 09:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qf511/afternoon\\\_magathread\\\_your\\\_weekly\\\_presidential/?utm\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 11:18PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qfobv/afternoon\\_magathread\\_your\\_weekly\\_presidential/?utm\\_source=iftttvia /MagaFirstNews
Submitted June 12, 2018 at 01:38AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qghk4/afternoon\_magathread\_your\_weekly\_presidential/?utm\_source=ifttt
via /MagaFirstNews
submitted by peterboykin to MagaFirstNews [link] [comments]


2018.06.12 07:38 peterboykin Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!

Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!
Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!HAPPPPPPY SATURDAY, PATRIOTS!This is your girl u/IvaginaryFriend back at it again with a weeks worth of spice for you lovely Deplorables! (◠‿◠✿)Before we officially get this recap started, if you happened to miss any past recaps you can catch them here!Also, don't forget about our Header contest coming up on Monday, June 11th!!! The winning submission will be proudly presented at the top of the DOM for the next few months!!!Now, let's get on with the show!Sunday, June 3rd:🔥🔥TRUMP TWEETS🔥🔥:Jesse Watters “The only thing Trump obstructed was Hillary getting to the White House.” So true!As only one of two people left who could become President, why wouldn’t the FBI or Department of “Justice” have told me that they were secretly investigating Paul Manafort (on charges that were 10 years old and had been previously dropped) during my campaign? Should have told me!....Paul Manafort came into the campaign very late and was with us for a short period of time (he represented Ronald Reagan, Bob Dole & many others over the years), but we should have been told that Comey and the boys were doing a number on him, and he wouldn’t have been hired!Mark Penn “Why are there people from the Clinton Foundation on the Mueller Staff? Why is there an Independent Counsel? To go after people and their families for unrelated offenses...Constitution was set up to prevent this...Stormtrooper tactics almost.” A disgrace!SIGNIFICANT TWEETS AND NEWS:WINNING! U.S. Beats Singapore & Hong Kong To Become The World's Most Competitive Economy Again - #MAGA!Roseanne Barr is off TV but Samantha Bee is still on -- just another example of the media’s double standardThis timeline is unexpected. In 2018, I have already skipped a Star Wars movie in the theatres and paid money for a Kanye West Album.THE MADMAN-Probably the best quote in human history to date🐸 TOP SPICE OF THE DAY 🐸:"oh they're so good, oh they're so sweet."Today is Trump's 500th day as POTUS so here is a commemorative $500 bill.This triggers leftists.FITTON: My first official meme for the TD"Cuz we hate him"Monday, June 4th:TODAY'S ACTION:Vice President Pence Delivers Remarks at a Reception Promoting a Hemisphere of FreedomPresident Donald J. Trump Announces Intent to Nominate Personnel to a Key Administration PostPresidential Memorandum for the Secretary of StatePresidential Memorandum for the Secretary of StateEight Nominations Sent to the Senate Today🔥🔥TRUMP TWEETS🔥🔥:This is my 500th. Day in Office and we have accomplished a lot - many believe more than any President in his first 500 days. Massive Tax & Regulation Cuts, Military & Vets, Lower Crime & Illegal Immigration, Stronger Borders, Judgeships, Best Economy & Jobs EVER, and much more... ....We had Repeal & Replace done (and the saving to our country of one trillion dollars) except for one person, but it is getting done anyway. Individual Mandate is gone and great, less expensive plans will be announced this month. Drug prices coming down & Right to Try!“This is the best time EVER to look for a job.” James Freeman of WSJ.As has been stated by numerous legal scholars, I have the absolute right to PARDON myself, but why would I do that when I have done nothing wrong? In the meantime, the never ending Witch Hunt, led by 13 very Angry and Conflicted Democrats (& others) continues into the mid-terms!China already charges a tax of 16% on soybeans. Canada has all sorts of trade barriers on our Agricultural products. Not acceptable!The U.S. has made such bad trade deals over so many years that we can only WIN!Farmers have not been doing well for 15 years. Mexico, Canada, China and others have treated them unfairly. By the time I finish trade talks, that will change. Big trade barriers against U.S. farmers, and other businesses, will finally be broken. Massive trade deficits no longer!The appointment of the Special Counsel is totally UNCONSTITUTIONAL! Despite that, we play the game because I, unlike the Democrats, have done nothing wrong!#500Days of American Greatness: http://45.wh.gov/gNWs8uThe Fake News Media is desperate to distract from the economy and record setting economic numbers and so they keep talking about the phony Russian Witch Hunt.In many ways this is the greatest economy in the HISTORY of America and the best time EVER to look for a job!Big Supreme Court ruling for Baker just out!The Philadelphia Eagles Football Team was invited to the White House. Unfortunately, only a small number of players decided to come, and we canceled the event. Staying in the Locker Room for the playing of our National Anthem is as disrespectful to our country as kneeling. Sorry!SIGNIFICANT TWEETS AND NEWS:Supreme Court rules 7-2 in favor of Colorado baker who refused to bake a wedding cake for a gay couple on religious grounds. SCOTUS finds that the Colorado Civil Rights Commission did not consider this case with religious neutrality and violated the Free Exercise Clause.Stand for the Anthem or don’t come. I love this President.Watch Bernie Sanders Run From Alex Jones At LAX Airport29 Years ago Today. This is Communism. Never Forget.The media was all about an outgoing Obama pardoning Incoming Hillary. Then they were cool with Hillary pardoning herself. But now, because it’s DJT, now it’s a “constitutional crisis.” Sorry ass complicit jerk-offs.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:worst boycott ever #MAGAJust saw this on another sub. Pretty accurate tbhThis is America.BREAKING: In a narrow 2,623-487 county decision, Trump wins the US electionBREAKING: In narrow 77-0 decision, Oklahoma goes entirely Republican.Tuesday, June 5th:TODAY'S ACTION:President Trump Participates in the Celebration of AmericaHerschel Walker at the White House Sports and Fitness DayNatalie Gulbis at the White House Sports and Fitness DayPresident Trump Participates in the Signing Ceremony for S. 292🔥🔥TRUMP TWEETS🔥🔥:What is taking so long with the Inspector General’s Report on Crooked Hillary and Slippery James Comey. Numerous delays. Hope Report is not being changed and made weaker! There are so many horrible things to tell, the public has the right to know. Transparency!The U.S. has an increased economic value of more than 7 Trillion Dollars since the Election. May be the best economy in the history of our country. Record Jobs numbers. Nice!We will proudly be playing the National Anthem and other wonderful music celebrating our Country today at 3 P.M., The White House, with the United States Marine Band and the United States Army Chorus. Honoring America! NFL, no escaping to Locker Rooms!We have had many Championship teams recently at the White House including the Chicago Cubs, Houston Astros, Pittsburgh Penguins, New England Patriots, Alabama and Clemson National Champions, and many others. National Anthem & more great music today at 3:00 P.M.The Russian Witch Hunt Hoax continues, all because Jeff Sessions didn’t tell me he was going to recuse himself...I would have quickly picked someone else. So much time and money wasted, so many lives ruined...and Sessions knew better than most that there was No Collusion!Meeting in Singapore with North Korea will hopefully be the start of something big...we will soon [email protected] and Champion @MartinTruex_Jr were recently at the White House. It was a great day for a great sport!Separating families at the Border is the fault of bad legislation passed by the Democrats. Border Security laws should be changed but the Dems can’t get their act together! Started the Wall.In High Tax, High Crime California, be sure to get out and vote for Republican John Cox for Governor. He will make a BIG difference!Get the vote out in California today for Rep. Kevin McCarthy and all of the great GOP candidates for Congress. Keep our country out of the hands of High Tax, High Crime Nancy Pelosi.Vote for Congressman Devin Nunes, a true American Patriot the likes of which we rarely see in our modern day world....he truly loves our country and deserves everyone’s support!Senator @RogerWicker of Mississippi has done everything necessary to Make America Great Again! Get out and vote for Roger, he has my total support!Terrific new book out by the wonderful Harris Faulkner, “9 Rules of Engagement.” Harris shares lessons from a military family. Enjoy!The HISTORIC Rescissions Package we’ve proposed would cut $15,000,000,000 in Wasteful Spending! We are getting our government back on track.Imagine how much wasteful spending we’d save if we didn’t have Chuck and Nancy standing in our way! For years, Democrats in Congress have depleted our military and busted our budgets on needless spending, and to what end? No more.Wow, Strzok-Page, the incompetent & corrupt FBI lovers, have texts referring to a counter-intelligence operation into the Trump Campaign dating way back to December, 2015. SPYGATE is in full force! Is the Mainstream Media interested yet? Big stuff!(Retweeting Robby Starbuck) Fox News has been #1 for 197 months straight. In the latest ratings disaster for CNN they lost another 25% of their viewers. Fox has 10 of the top 15 shows and even hold the #1 spot in the younger key demo. The public is loudly rejecting @CNN.(Retweeting Eric Trump) #MakeAmericaGreatAgain 🇺🇸🇺🇸🇺🇸(Retweeting Brad Parscale) Since the #FakeNews is full of distortions, underreporting, and lies, we launched a platform tonight presenting a comprehensive record of @realDonaldTrump’s administration. The truth will be told about a remarkable 500-day record of accomplishments!Great interview by @LouDobbs with Chris Farrell of Judicial Watch concerning the governments counter-intelligence operation into the Trump Campaign. SPYGATE at the highest level. Who would believe? 10,534 replies 12,776 retweets 50,227 likesChris Farrell, Judicial Watch. “They were running an operation to undermine a candidate for President of the U.S. These are all violations of law. This is intelligence tradecraft to steer an election. There’s nothing more grave when it comes to abuse of our intelligence system... ... ...This is a level of criminality beyond the pale. This is such a grave abuse of power and authority, it’s like nothing else we’ve seen in our history. This makes the Nixon Watergate burglary look like keystone cop stuff....The greatest Witch Hunt in political history!Mitch McConnell announced he will cancel the Senate’s August Recess. Great, maybe the Democrats will finally get something done other than their acceptance of High Crime and High Taxes. We need Border Security!SIGNIFICANT TWEETS AND NEWS:For the first time in recorded American history the U.S. Department of Labor reports: Job openings exceed number of job seekers. (That.... Mr Obama is a fucking magic wand)TRUMP ON MIDTERMS: WE CANNOT BE COMPLACENT. GET OUT AND VOTE AL, IA, MS, MT, NJ, NM & SD!!Page/Strokz emails including the changing of the verbiage to exhonerate ClintonAndrew McCabe seeks immunity for testimony in congressional hearingTHIS IS YUUUUUUGE:U.S. Senate Majority Leader Mitch McConnell canceled the Senate's traditional August recess, citing Democrats' "historic obstruction" to pass legislation.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:The Blue Wave. Proof. It's Happening. The Democrats are "unstoppable".Different kids of diets😂 This past weekend #Antifa came out to play in the Pacific Northwest and did they ever get a surprise!GeniusDon't let the world forget KateTfw the OIG is taking so long with the report on Crooked Hillary and Slippery James ComeyWednesday, June 6th:TODAY'S ACTION:President Trump Participates in the Signing Ceremony for S. 2372 – VA Mission Act of 2018President Trump Signs VA Mission Act of 2018 into LawPresident Trump and Vice President Pence Attend the 2018 Hurricane Briefing at FEMA HQPresident Trump Delivers Remarks After the 2018 Hurricane Briefing at FEMA HQPresident Trump Hosts the White House IFTARPresident Donald J. Trump Announces Intent to Nominate and Appoint Personnel to Key Administration PostsPresident Donald J. Trump Announces Appointments for the Executive Office of the President🔥🔥TRUMP TWEETS🔥🔥:Great night for Republicans! Congratulations to John Cox on a really big number in California. He can win. Even Fake News CNN said the Trump impact was really big, much bigger than they ever thought possible. So much for the big Blue Wave, it may be a big Red Wave. Working hard!Gold Star father, Ceejay Metcalf, whose great son Michael was just honored at the White House, was fantastic this morning on @foxandfriends. He is a special man!The Fake News Media has been so unfair, and vicious, to my wife and our great First Lady, Melania. During her recovery from surgery they reported everything from near death, to facelift, to left the W.H. (and me) for N.Y. or Virginia, to abuse. All Fake, she is doing really well!...Four reporters spotted Melania in the White House last week walking merrily along to a meeting. They never reported the sighting because it would hurt the sick narrative that she was living in a different part of the world, was really ill, or whatever. Fake News is really bad!Many more Republican voters showed up yesterday than the Fake News thought possible. The political pundits just don’t get what is going on out there - or they do get it but refuse to report the facts! Remember, Dems are High Tax, High Crime, easy to beat!Congratulations to Dana Rohrabacher on his big California win. We are proud of you Dana!Today we mark another milestone: the 74th anniversary of #DDay, the Allied invasion of Normandy. On June 6, 1944, more than 70,000 brave young Americans charged out of landing craft, jumped out of airplanes, and stormed into hell...We must always protect those who protect us. Today, it was my great honor to sign the #VAMissionAct and to make Veterans Choice the permanent law of the land! http://45.wh.gov/dyWJNqThank you to everyone at @FEMA HQ for today’s briefing on preparations for the upcoming hurricane season. Disaster response and recovery is best achieved when it’s federally supported, state managed, and locally executed – this is the successful model we will continue to build.SIGNIFICANT TWEETS AND NEWS:Seventy-four years ago today American patriots fought and died by the thousands to stop real fascism, racial genocide, and oppression. Let's remember these brave Americans who gave it all so Soy Boys today can claim every patriotic American is a fascist and racist without a hint of irony. D-Day 44Steve Scalise back on the field today.BOMBSHELL REPORT: The Obama administration granted a license letting Iran access the United States financial system despite officials’ pledges that they would prohibit itPromisesKept.com President Donald J. Trump's AccomplishmentsHenry Winkler says he was among 118,000 voters 'left off' Los Angeles County rosters Fox NewsThe Most Ignored Bombshell of 2017: Samantha Power was caught using her security clearance as a UN ambassador to review private conversations by U.S. citizens 260 times in the 2016 election year... She said that someone else in the Obama White House did this, using her security clearance.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:This is AmericaThe most important comment I've ever made. If this message resonates with even one person then I will have made the world a better place.Commander of CheeseheadsMiss America crowned in advance! Judges cite her YUGE brains and charity work with mentally impaired media as key factors! Beautiful person!Thursday, June 7th:TODAY'S ACTION:They Said It Couldn't Be DonePresident Trumps Meets with the Prime Minister of JapanPresident Trump Hosts a Joint Press Conference with the Prime Minister of JapanPresident Trump Welcomes Prime Minister Shinzō Abe of Japan to the White House[]()🔥🔥TRUMP TWEETS🔥🔥:Isn’t it Ironic? Getting ready to go to the G-7 in Canada to fight for our country on Trade (we have the worst trade deals ever made), then off to Singapore to meet with North Korea & the Nuclear Problem...But back home we still have the 13 Angry Democrats pushing the Witch Hunt!Good luck to Alice Johnson. Have a wonderful life!Alan Dershowitz, Harvard Law Professor: “It all proves that we never needed a Special Counsel....All of this could have been done by the Justice Dept. Don’t need a multi-million dollar group of people with a target on someone’s back. Not the way Justice should operate.” So true!When and where will all of the many conflicts of interest be listed by the 13 Angry Democrats (plus) working on the Witch Hunt Hoax. There has never been a group of people on a case so biased or conflicted. It is all a Democrat Excuse for LOSING the Election. Where is the server?How could Jeff Flake, who is setting record low polling numbers in Arizona and was therefore humiliatingly forced out of his own Senate seat without even a fight (and who doesn’t have a clue), think about running for office, even a lower one, again? Let’s face it, he’s a Flake!Looking forward to seeing my friend Prime Minister @AbeShinzo of Japan at noon. Will be discussing North Korea and Trade.Our Justice Department must not let Awan & Debbie Wasserman Schultz off the hook. The Democrat I.T. scandal is a key to much of the corruption we see today. They want to make a “plea deal” to hide what is on their Server. Where is Server? Really bad!When will people start saying, “thank you, Mr. President, for firing James Comey?”The Obama Administration is now accused of trying to give Iran secret access to the financial system of the United States. This is totally illegal. Perhaps we could get the 13 Angry Democrats to divert some of their energy to this “matter” (as Comey would call it). Investigate!“Total jobless claims running at lowest level in 44 years”“$3 billion payoff: 101 utilities cut rates, credit GOP tax cuts”MAKING AMERICA GREAT AGAIN!It’s my great honor to welcome Prime Minister @AbeShinzo back to the @WhiteHouse!🇺🇸🇯🇵Today, I am greatly honored to welcome my good friend, PM Abe of Japan to the @WhiteHouse. Over the past 16 months the Prime Minister and I have worked closely together to address common challenges, of which there are many...PM Abe and I are also working to improve the trading relationship between the U.S. and Japan, something we have to do. The U.S. seeks a bilateral deal with Japan that is based on the principle of fairness and reciprocity. We’re working hard to reduce our trade imbalance...Great day of meetings with Prime Minister @AbeShinzo of Japan!Please tell Prime Minister Trudeau and President Macron that they are charging the U.S. massive tariffs and create non-monetary barriers. The EU trade surplus with the U.S. is $151 Billion, and Canada keeps our farmers and others out. Look forward to seeing them tomorrow.Prime Minister Trudeau is being so indignant, bringing up the relationship that the U.S. and Canada had over the many years and all sorts of other things...but he doesn’t bring up the fact that they charge us up to 300% on dairy — hurting our Farmers, killing our Agriculture!Why isn’t the European Union and Canada informing the public that for years they have used massive Trade Tariffs and non-monetary Trade Barriers against the U.S. Totally unfair to our farmers, workers & companies. Take down your tariffs & barriers or we will more than match you!SIGNIFICANT TWEETS AND NEWS:OUTRAGEOUS! New IG Report - Social Security Benefits paid to DACA! Illegals are receiving OUR Social Security Benefits!The Kent State 2A girl is a god-tier shitposter.MSNBC Calls Daughter Of Pardoned Alice Johnson — She Can’t Stop Thanking TrumpTime Magazine honors Trump again!!! Beautiful cover. The left can’t meme.LOL! Sean Hannity is trending on Twitter because he jokingly told "witnesses" to smash their phones with hammers before handing them over to Mueller. Stupid Liberals are saying he is tampering with evidence. They probably dont know thats what Hillary actually did.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:This is AmericaGrandfather was born a slave, mother was born a refugee, I was born freeThere are only 2 genders, and if you disagree then you're an Islamophobe. Leftist SJWs BTFO!Mirror, Mirror on THE WALL, who's the WOKEST of us ALL??Friday, June 8th:TODAY'S ACTION:President Donald J. Trump Proclaims June 14, 2018 as Flag Day and the Week Starting June 10, 2018 as National Flag WeekPresident Trump Delivers a Statement Upon DeparturePresident Trump Participates in an Expanded Bilateral Meeting with the Prime Minister of CanadaPresident Trump Participates in a Bilateral Meeting with the President of the French Republic🔥🔥TRUMP TWEETS🔥🔥:Obama, Schumer and Pelosi did NOTHING about North Korea, and now weak on Crime, High Tax Schumer is telling me what to do at the Summit the Dems could never set up. Schumer failed with North Korea and Iran, we don’t need his advice!Canada charges the U.S. a 270% tariff on Dairy Products! They didn’t tell you that, did they? Not fair to our farmers!Looking forward to straightening out unfair Trade Deals with the G-7 countries. If it doesn’t happen, we come out even better!Congratulations to the Washington Capitals on their GREAT play and winning the Stanley Cup Championship. Alex Ovechkin, the team captain, was spectacular - a true Superstar! D.C. is popping, in many ways. What a time!I am heading for Canada and the G-7 for talks that will mostly center on the long time unfair trade practiced against the United States. From there I go to Singapore and talks with North Korea on Denuclearization. Won’t be talking about the Russian Witch Hunt Hoax for a while!My thoughts and prayers are with the families of our serviceman who was killed and his fellow servicemen who were wounded in Somalia. They are truly all HEROES.(Retweeting G7 Canada) Day 1 of #G7Charlevoix in 60 seconds.SIGNIFICANT TWEETS AND NEWS:President Trump confirms intent to sign states' rights cannabis bill that was introduced in Congress yesterdayPewdiepie reuploads video exposing CNN and Hillary Clinton after it got copystriked and deleted!BAHAHAHAHAHA.............BAHAJSJSKGLGOGICSteam refuses to bend the knee to SJWs, choosing to stand with community - All content that is legal will be allowed.BREAKING: Trump tells kneeling NFL players to recommend people to pardon, since that's what they're supposedly protesting. Their reason to kneel just died. LOL🐸 TOP SPICE OF THE DAY 🐸:When you're surrounded by globalistsPresstitutesHookers for Hillary, I should have known...ARCHIVE: "Sleeping with your source- especially a vindictive congressman?" - Ali Watkins, 2013Saturday, June 10th:TODAY'S ACTION:President Trump delivers a statementSIGNIFICANT TWEETS AND NEWS:Ali Watkins not getting the probe she had hoped for; Feds have seized her email and phone records for investigation on James Wolfe!HOLY SHIT Last night Bill Maher said what every lefitist truly thinks but might not say out loud: That he HOPES FOR A RECESSION to hurt President Trump. They'd rather see our country fail if it means Trump won't succeed. This is peak Trump derangement, folks. SAD!James Wolfe Leak Investigation: Journalists Insist on a Double Standard - Andrew McCarthyNew italian PM Conte on Facebook: Historic alliance, new friendship 🤝 - Can't get tired of all this winning, MAGA and MIGA!!! 🍝🍔BREAKING: Seth Rich's Brother's Attorneys Subpoena Twitter to Turn Over All Direct Messages from: Wikileaks, Julian Assange, KimDotCom, Cassandra Fairbanks, Gateway Pundit, etc🐸 TOP SPICE OF THE DAY 🐸:The God Emperor and his court JesterUSA and Canada 🇺🇲🇨🇦Not a drill: European Union banning memes (seriously).Dressed up for me best friend Melania.So Much Winning, STILL NOT TIRED OF IT!!As always, some tunes to get you jamming through this long list of winning;Ghost Town4th DimensionNo MistakesWatchWhat Would Meek do?MAGA ON PATRIOTS!Submitted June 09, 2018 at 11:48AM by Ivaginaryfriend https://www.reddit.com/The\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_Donald/comments/8ptnk6/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /The_DonaldSubmitted June 09, 2018 at 12:48PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pu2ln/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pun4d/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 06:13PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pwc8s/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 07:13PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pwpq2/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 08:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pxdfj/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 10:18PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pxu3a/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 11:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pydsj/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 12:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pynsafternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 02:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pz72afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 03:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pzfe1/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 06:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q02kv/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 08:43AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q0jrp/afternoon\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 09:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q0s8t/afternoon\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 10:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q1bf2/afternoon\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 12:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q1y1t/afternoon\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q2m9o/afternoon\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 05:28PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q41fu/afternoon\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 06:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q4hwafternoon\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 08:23PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q57mj/afternoon\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 09:28PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q5lxs/afternoon\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 11:48PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q6hj6/afternoon\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 12:18AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q6o1m/afternoon\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 01:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q71kt/afternoon\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\_your\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 02:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q7hym/afternoon\\\\\\\\\\\\_magathread\\\\\\\\\\\\_your\\\\\\\\\\\\_weekly\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 03:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q7sgi/afternoon\\\\\\\\\\\_magathread\\\\\\\\\\\_your\\\\\\\\\\\_weekly\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 06:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q8lkv/afternoon\\\\\\\\\\_magathread\\\\\\\\\\_your\\\\\\\\\\_weekly\\\\\\\\\\_presidential/?utm\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 08:23AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q93tt/afternoon\\\\\\\\\_magathread\\\\\\\\\_your\\\\\\\\\_weekly\\\\\\\\\_presidential/?utm\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 09:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q9iv4/afternoon\\\\\\\\_magathread\\\\\\\\_your\\\\\\\\_weekly\\\\\\\\_presidential/?utm\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 10:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qa4xafternoon\\\\\\\_magathread\\\\\\\_your\\\\\\\_weekly\\\\\\\_presidential/?utm\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 12:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qavpx/afternoon\\\\\\_magathread\\\\\\_your\\\\\\_weekly\\\\\\_presidential/?utm\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qbjwj/afternoon\\\\\_magathread\\\\\_your\\\\\_weekly\\\\\_presidential/?utm\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 06:38PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qdrii/afternoon\\\\_magathread\\\\_your\\\\_weekly\\\\_presidential/?utm\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 08:23PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qehmo/afternoon\\\_magathread\\\_your\\\_weekly\\\_presidential/?utm\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 09:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qf511/afternoon\\_magathread\\_your\\_weekly\\_presidential/?utm\\_source=iftttvia /MagaFirstNews
Submitted June 11, 2018 at 11:18PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qfobv/afternoon\_magathread\_your\_weekly\_presidential/?utm\_source=ifttt
via /MagaFirstNews
submitted by peterboykin to MagaFirstNews [link] [comments]


2018.06.12 05:18 peterboykin Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!

Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!
Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!HAPPPPPPY SATURDAY, PATRIOTS!This is your girl u/IvaginaryFriend back at it again with a weeks worth of spice for you lovely Deplorables! (◠‿◠✿)Before we officially get this recap started, if you happened to miss any past recaps you can catch them here!Also, don't forget about our Header contest coming up on Monday, June 11th!!! The winning submission will be proudly presented at the top of the DOM for the next few months!!!Now, let's get on with the show!Sunday, June 3rd:🔥🔥TRUMP TWEETS🔥🔥:Jesse Watters “The only thing Trump obstructed was Hillary getting to the White House.” So true!As only one of two people left who could become President, why wouldn’t the FBI or Department of “Justice” have told me that they were secretly investigating Paul Manafort (on charges that were 10 years old and had been previously dropped) during my campaign? Should have told me!....Paul Manafort came into the campaign very late and was with us for a short period of time (he represented Ronald Reagan, Bob Dole & many others over the years), but we should have been told that Comey and the boys were doing a number on him, and he wouldn’t have been hired!Mark Penn “Why are there people from the Clinton Foundation on the Mueller Staff? Why is there an Independent Counsel? To go after people and their families for unrelated offenses...Constitution was set up to prevent this...Stormtrooper tactics almost.” A disgrace!SIGNIFICANT TWEETS AND NEWS:WINNING! U.S. Beats Singapore & Hong Kong To Become The World's Most Competitive Economy Again - #MAGA!Roseanne Barr is off TV but Samantha Bee is still on -- just another example of the media’s double standardThis timeline is unexpected. In 2018, I have already skipped a Star Wars movie in the theatres and paid money for a Kanye West Album.THE MADMAN-Probably the best quote in human history to date🐸 TOP SPICE OF THE DAY 🐸:"oh they're so good, oh they're so sweet."Today is Trump's 500th day as POTUS so here is a commemorative $500 bill.This triggers leftists.FITTON: My first official meme for the TD"Cuz we hate him"Monday, June 4th:TODAY'S ACTION:Vice President Pence Delivers Remarks at a Reception Promoting a Hemisphere of FreedomPresident Donald J. Trump Announces Intent to Nominate Personnel to a Key Administration PostPresidential Memorandum for the Secretary of StatePresidential Memorandum for the Secretary of StateEight Nominations Sent to the Senate Today🔥🔥TRUMP TWEETS🔥🔥:This is my 500th. Day in Office and we have accomplished a lot - many believe more than any President in his first 500 days. Massive Tax & Regulation Cuts, Military & Vets, Lower Crime & Illegal Immigration, Stronger Borders, Judgeships, Best Economy & Jobs EVER, and much more... ....We had Repeal & Replace done (and the saving to our country of one trillion dollars) except for one person, but it is getting done anyway. Individual Mandate is gone and great, less expensive plans will be announced this month. Drug prices coming down & Right to Try!“This is the best time EVER to look for a job.” James Freeman of WSJ.As has been stated by numerous legal scholars, I have the absolute right to PARDON myself, but why would I do that when I have done nothing wrong? In the meantime, the never ending Witch Hunt, led by 13 very Angry and Conflicted Democrats (& others) continues into the mid-terms!China already charges a tax of 16% on soybeans. Canada has all sorts of trade barriers on our Agricultural products. Not acceptable!The U.S. has made such bad trade deals over so many years that we can only WIN!Farmers have not been doing well for 15 years. Mexico, Canada, China and others have treated them unfairly. By the time I finish trade talks, that will change. Big trade barriers against U.S. farmers, and other businesses, will finally be broken. Massive trade deficits no longer!The appointment of the Special Counsel is totally UNCONSTITUTIONAL! Despite that, we play the game because I, unlike the Democrats, have done nothing wrong!#500Days of American Greatness: http://45.wh.gov/gNWs8uThe Fake News Media is desperate to distract from the economy and record setting economic numbers and so they keep talking about the phony Russian Witch Hunt.In many ways this is the greatest economy in the HISTORY of America and the best time EVER to look for a job!Big Supreme Court ruling for Baker just out!The Philadelphia Eagles Football Team was invited to the White House. Unfortunately, only a small number of players decided to come, and we canceled the event. Staying in the Locker Room for the playing of our National Anthem is as disrespectful to our country as kneeling. Sorry!SIGNIFICANT TWEETS AND NEWS:Supreme Court rules 7-2 in favor of Colorado baker who refused to bake a wedding cake for a gay couple on religious grounds. SCOTUS finds that the Colorado Civil Rights Commission did not consider this case with religious neutrality and violated the Free Exercise Clause.Stand for the Anthem or don’t come. I love this President.Watch Bernie Sanders Run From Alex Jones At LAX Airport29 Years ago Today. This is Communism. Never Forget.The media was all about an outgoing Obama pardoning Incoming Hillary. Then they were cool with Hillary pardoning herself. But now, because it’s DJT, now it’s a “constitutional crisis.” Sorry ass complicit jerk-offs.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:worst boycott ever #MAGAJust saw this on another sub. Pretty accurate tbhThis is America.BREAKING: In a narrow 2,623-487 county decision, Trump wins the US electionBREAKING: In narrow 77-0 decision, Oklahoma goes entirely Republican.Tuesday, June 5th:TODAY'S ACTION:President Trump Participates in the Celebration of AmericaHerschel Walker at the White House Sports and Fitness DayNatalie Gulbis at the White House Sports and Fitness DayPresident Trump Participates in the Signing Ceremony for S. 292🔥🔥TRUMP TWEETS🔥🔥:What is taking so long with the Inspector General’s Report on Crooked Hillary and Slippery James Comey. Numerous delays. Hope Report is not being changed and made weaker! There are so many horrible things to tell, the public has the right to know. Transparency!The U.S. has an increased economic value of more than 7 Trillion Dollars since the Election. May be the best economy in the history of our country. Record Jobs numbers. Nice!We will proudly be playing the National Anthem and other wonderful music celebrating our Country today at 3 P.M., The White House, with the United States Marine Band and the United States Army Chorus. Honoring America! NFL, no escaping to Locker Rooms!We have had many Championship teams recently at the White House including the Chicago Cubs, Houston Astros, Pittsburgh Penguins, New England Patriots, Alabama and Clemson National Champions, and many others. National Anthem & more great music today at 3:00 P.M.The Russian Witch Hunt Hoax continues, all because Jeff Sessions didn’t tell me he was going to recuse himself...I would have quickly picked someone else. So much time and money wasted, so many lives ruined...and Sessions knew better than most that there was No Collusion!Meeting in Singapore with North Korea will hopefully be the start of something big...we will soon [email protected] and Champion @MartinTruex_Jr were recently at the White House. It was a great day for a great sport!Separating families at the Border is the fault of bad legislation passed by the Democrats. Border Security laws should be changed but the Dems can’t get their act together! Started the Wall.In High Tax, High Crime California, be sure to get out and vote for Republican John Cox for Governor. He will make a BIG difference!Get the vote out in California today for Rep. Kevin McCarthy and all of the great GOP candidates for Congress. Keep our country out of the hands of High Tax, High Crime Nancy Pelosi.Vote for Congressman Devin Nunes, a true American Patriot the likes of which we rarely see in our modern day world....he truly loves our country and deserves everyone’s support!Senator @RogerWicker of Mississippi has done everything necessary to Make America Great Again! Get out and vote for Roger, he has my total support!Terrific new book out by the wonderful Harris Faulkner, “9 Rules of Engagement.” Harris shares lessons from a military family. Enjoy!The HISTORIC Rescissions Package we’ve proposed would cut $15,000,000,000 in Wasteful Spending! We are getting our government back on track.Imagine how much wasteful spending we’d save if we didn’t have Chuck and Nancy standing in our way! For years, Democrats in Congress have depleted our military and busted our budgets on needless spending, and to what end? No more.Wow, Strzok-Page, the incompetent & corrupt FBI lovers, have texts referring to a counter-intelligence operation into the Trump Campaign dating way back to December, 2015. SPYGATE is in full force! Is the Mainstream Media interested yet? Big stuff!(Retweeting Robby Starbuck) Fox News has been #1 for 197 months straight. In the latest ratings disaster for CNN they lost another 25% of their viewers. Fox has 10 of the top 15 shows and even hold the #1 spot in the younger key demo. The public is loudly rejecting @CNN.(Retweeting Eric Trump) #MakeAmericaGreatAgain 🇺🇸🇺🇸🇺🇸(Retweeting Brad Parscale) Since the #FakeNews is full of distortions, underreporting, and lies, we launched a platform tonight presenting a comprehensive record of @realDonaldTrump’s administration. The truth will be told about a remarkable 500-day record of accomplishments!Great interview by @LouDobbs with Chris Farrell of Judicial Watch concerning the governments counter-intelligence operation into the Trump Campaign. SPYGATE at the highest level. Who would believe? 10,534 replies 12,776 retweets 50,227 likesChris Farrell, Judicial Watch. “They were running an operation to undermine a candidate for President of the U.S. These are all violations of law. This is intelligence tradecraft to steer an election. There’s nothing more grave when it comes to abuse of our intelligence system... ... ...This is a level of criminality beyond the pale. This is such a grave abuse of power and authority, it’s like nothing else we’ve seen in our history. This makes the Nixon Watergate burglary look like keystone cop stuff....The greatest Witch Hunt in political history!Mitch McConnell announced he will cancel the Senate’s August Recess. Great, maybe the Democrats will finally get something done other than their acceptance of High Crime and High Taxes. We need Border Security!SIGNIFICANT TWEETS AND NEWS:For the first time in recorded American history the U.S. Department of Labor reports: Job openings exceed number of job seekers. (That.... Mr Obama is a fucking magic wand)TRUMP ON MIDTERMS: WE CANNOT BE COMPLACENT. GET OUT AND VOTE AL, IA, MS, MT, NJ, NM & SD!!Page/Strokz emails including the changing of the verbiage to exhonerate ClintonAndrew McCabe seeks immunity for testimony in congressional hearingTHIS IS YUUUUUUGE:U.S. Senate Majority Leader Mitch McConnell canceled the Senate's traditional August recess, citing Democrats' "historic obstruction" to pass legislation.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:The Blue Wave. Proof. It's Happening. The Democrats are "unstoppable".Different kids of diets😂 This past weekend #Antifa came out to play in the Pacific Northwest and did they ever get a surprise!GeniusDon't let the world forget KateTfw the OIG is taking so long with the report on Crooked Hillary and Slippery James ComeyWednesday, June 6th:TODAY'S ACTION:President Trump Participates in the Signing Ceremony for S. 2372 – VA Mission Act of 2018President Trump Signs VA Mission Act of 2018 into LawPresident Trump and Vice President Pence Attend the 2018 Hurricane Briefing at FEMA HQPresident Trump Delivers Remarks After the 2018 Hurricane Briefing at FEMA HQPresident Trump Hosts the White House IFTARPresident Donald J. Trump Announces Intent to Nominate and Appoint Personnel to Key Administration PostsPresident Donald J. Trump Announces Appointments for the Executive Office of the President🔥🔥TRUMP TWEETS🔥🔥:Great night for Republicans! Congratulations to John Cox on a really big number in California. He can win. Even Fake News CNN said the Trump impact was really big, much bigger than they ever thought possible. So much for the big Blue Wave, it may be a big Red Wave. Working hard!Gold Star father, Ceejay Metcalf, whose great son Michael was just honored at the White House, was fantastic this morning on @foxandfriends. He is a special man!The Fake News Media has been so unfair, and vicious, to my wife and our great First Lady, Melania. During her recovery from surgery they reported everything from near death, to facelift, to left the W.H. (and me) for N.Y. or Virginia, to abuse. All Fake, she is doing really well!...Four reporters spotted Melania in the White House last week walking merrily along to a meeting. They never reported the sighting because it would hurt the sick narrative that she was living in a different part of the world, was really ill, or whatever. Fake News is really bad!Many more Republican voters showed up yesterday than the Fake News thought possible. The political pundits just don’t get what is going on out there - or they do get it but refuse to report the facts! Remember, Dems are High Tax, High Crime, easy to beat!Congratulations to Dana Rohrabacher on his big California win. We are proud of you Dana!Today we mark another milestone: the 74th anniversary of #DDay, the Allied invasion of Normandy. On June 6, 1944, more than 70,000 brave young Americans charged out of landing craft, jumped out of airplanes, and stormed into hell...We must always protect those who protect us. Today, it was my great honor to sign the #VAMissionAct and to make Veterans Choice the permanent law of the land! http://45.wh.gov/dyWJNqThank you to everyone at @FEMA HQ for today’s briefing on preparations for the upcoming hurricane season. Disaster response and recovery is best achieved when it’s federally supported, state managed, and locally executed – this is the successful model we will continue to build.SIGNIFICANT TWEETS AND NEWS:Seventy-four years ago today American patriots fought and died by the thousands to stop real fascism, racial genocide, and oppression. Let's remember these brave Americans who gave it all so Soy Boys today can claim every patriotic American is a fascist and racist without a hint of irony. D-Day 44Steve Scalise back on the field today.BOMBSHELL REPORT: The Obama administration granted a license letting Iran access the United States financial system despite officials’ pledges that they would prohibit itPromisesKept.com President Donald J. Trump's AccomplishmentsHenry Winkler says he was among 118,000 voters 'left off' Los Angeles County rosters Fox NewsThe Most Ignored Bombshell of 2017: Samantha Power was caught using her security clearance as a UN ambassador to review private conversations by U.S. citizens 260 times in the 2016 election year... She said that someone else in the Obama White House did this, using her security clearance.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:This is AmericaThe most important comment I've ever made. If this message resonates with even one person then I will have made the world a better place.Commander of CheeseheadsMiss America crowned in advance! Judges cite her YUGE brains and charity work with mentally impaired media as key factors! Beautiful person!Thursday, June 7th:TODAY'S ACTION:They Said It Couldn't Be DonePresident Trumps Meets with the Prime Minister of JapanPresident Trump Hosts a Joint Press Conference with the Prime Minister of JapanPresident Trump Welcomes Prime Minister Shinzō Abe of Japan to the White House[]()🔥🔥TRUMP TWEETS🔥🔥:Isn’t it Ironic? Getting ready to go to the G-7 in Canada to fight for our country on Trade (we have the worst trade deals ever made), then off to Singapore to meet with North Korea & the Nuclear Problem...But back home we still have the 13 Angry Democrats pushing the Witch Hunt!Good luck to Alice Johnson. Have a wonderful life!Alan Dershowitz, Harvard Law Professor: “It all proves that we never needed a Special Counsel....All of this could have been done by the Justice Dept. Don’t need a multi-million dollar group of people with a target on someone’s back. Not the way Justice should operate.” So true!When and where will all of the many conflicts of interest be listed by the 13 Angry Democrats (plus) working on the Witch Hunt Hoax. There has never been a group of people on a case so biased or conflicted. It is all a Democrat Excuse for LOSING the Election. Where is the server?How could Jeff Flake, who is setting record low polling numbers in Arizona and was therefore humiliatingly forced out of his own Senate seat without even a fight (and who doesn’t have a clue), think about running for office, even a lower one, again? Let’s face it, he’s a Flake!Looking forward to seeing my friend Prime Minister @AbeShinzo of Japan at noon. Will be discussing North Korea and Trade.Our Justice Department must not let Awan & Debbie Wasserman Schultz off the hook. The Democrat I.T. scandal is a key to much of the corruption we see today. They want to make a “plea deal” to hide what is on their Server. Where is Server? Really bad!When will people start saying, “thank you, Mr. President, for firing James Comey?”The Obama Administration is now accused of trying to give Iran secret access to the financial system of the United States. This is totally illegal. Perhaps we could get the 13 Angry Democrats to divert some of their energy to this “matter” (as Comey would call it). Investigate!“Total jobless claims running at lowest level in 44 years”“$3 billion payoff: 101 utilities cut rates, credit GOP tax cuts”MAKING AMERICA GREAT AGAIN!It’s my great honor to welcome Prime Minister @AbeShinzo back to the @WhiteHouse!🇺🇸🇯🇵Today, I am greatly honored to welcome my good friend, PM Abe of Japan to the @WhiteHouse. Over the past 16 months the Prime Minister and I have worked closely together to address common challenges, of which there are many...PM Abe and I are also working to improve the trading relationship between the U.S. and Japan, something we have to do. The U.S. seeks a bilateral deal with Japan that is based on the principle of fairness and reciprocity. We’re working hard to reduce our trade imbalance...Great day of meetings with Prime Minister @AbeShinzo of Japan!Please tell Prime Minister Trudeau and President Macron that they are charging the U.S. massive tariffs and create non-monetary barriers. The EU trade surplus with the U.S. is $151 Billion, and Canada keeps our farmers and others out. Look forward to seeing them tomorrow.Prime Minister Trudeau is being so indignant, bringing up the relationship that the U.S. and Canada had over the many years and all sorts of other things...but he doesn’t bring up the fact that they charge us up to 300% on dairy — hurting our Farmers, killing our Agriculture!Why isn’t the European Union and Canada informing the public that for years they have used massive Trade Tariffs and non-monetary Trade Barriers against the U.S. Totally unfair to our farmers, workers & companies. Take down your tariffs & barriers or we will more than match you!SIGNIFICANT TWEETS AND NEWS:OUTRAGEOUS! New IG Report - Social Security Benefits paid to DACA! Illegals are receiving OUR Social Security Benefits!The Kent State 2A girl is a god-tier shitposter.MSNBC Calls Daughter Of Pardoned Alice Johnson — She Can’t Stop Thanking TrumpTime Magazine honors Trump again!!! Beautiful cover. The left can’t meme.LOL! Sean Hannity is trending on Twitter because he jokingly told "witnesses" to smash their phones with hammers before handing them over to Mueller. Stupid Liberals are saying he is tampering with evidence. They probably dont know thats what Hillary actually did.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:This is AmericaGrandfather was born a slave, mother was born a refugee, I was born freeThere are only 2 genders, and if you disagree then you're an Islamophobe. Leftist SJWs BTFO!Mirror, Mirror on THE WALL, who's the WOKEST of us ALL??Friday, June 8th:TODAY'S ACTION:President Donald J. Trump Proclaims June 14, 2018 as Flag Day and the Week Starting June 10, 2018 as National Flag WeekPresident Trump Delivers a Statement Upon DeparturePresident Trump Participates in an Expanded Bilateral Meeting with the Prime Minister of CanadaPresident Trump Participates in a Bilateral Meeting with the President of the French Republic🔥🔥TRUMP TWEETS🔥🔥:Obama, Schumer and Pelosi did NOTHING about North Korea, and now weak on Crime, High Tax Schumer is telling me what to do at the Summit the Dems could never set up. Schumer failed with North Korea and Iran, we don’t need his advice!Canada charges the U.S. a 270% tariff on Dairy Products! They didn’t tell you that, did they? Not fair to our farmers!Looking forward to straightening out unfair Trade Deals with the G-7 countries. If it doesn’t happen, we come out even better!Congratulations to the Washington Capitals on their GREAT play and winning the Stanley Cup Championship. Alex Ovechkin, the team captain, was spectacular - a true Superstar! D.C. is popping, in many ways. What a time!I am heading for Canada and the G-7 for talks that will mostly center on the long time unfair trade practiced against the United States. From there I go to Singapore and talks with North Korea on Denuclearization. Won’t be talking about the Russian Witch Hunt Hoax for a while!My thoughts and prayers are with the families of our serviceman who was killed and his fellow servicemen who were wounded in Somalia. They are truly all HEROES.(Retweeting G7 Canada) Day 1 of #G7Charlevoix in 60 seconds.SIGNIFICANT TWEETS AND NEWS:President Trump confirms intent to sign states' rights cannabis bill that was introduced in Congress yesterdayPewdiepie reuploads video exposing CNN and Hillary Clinton after it got copystriked and deleted!BAHAHAHAHAHA.............BAHAJSJSKGLGOGICSteam refuses to bend the knee to SJWs, choosing to stand with community - All content that is legal will be allowed.BREAKING: Trump tells kneeling NFL players to recommend people to pardon, since that's what they're supposedly protesting. Their reason to kneel just died. LOL🐸 TOP SPICE OF THE DAY 🐸:When you're surrounded by globalistsPresstitutesHookers for Hillary, I should have known...ARCHIVE: "Sleeping with your source- especially a vindictive congressman?" - Ali Watkins, 2013Saturday, June 10th:TODAY'S ACTION:President Trump delivers a statementSIGNIFICANT TWEETS AND NEWS:Ali Watkins not getting the probe she had hoped for; Feds have seized her email and phone records for investigation on James Wolfe!HOLY SHIT Last night Bill Maher said what every lefitist truly thinks but might not say out loud: That he HOPES FOR A RECESSION to hurt President Trump. They'd rather see our country fail if it means Trump won't succeed. This is peak Trump derangement, folks. SAD!James Wolfe Leak Investigation: Journalists Insist on a Double Standard - Andrew McCarthyNew italian PM Conte on Facebook: Historic alliance, new friendship 🤝 - Can't get tired of all this winning, MAGA and MIGA!!! 🍝🍔BREAKING: Seth Rich's Brother's Attorneys Subpoena Twitter to Turn Over All Direct Messages from: Wikileaks, Julian Assange, KimDotCom, Cassandra Fairbanks, Gateway Pundit, etc🐸 TOP SPICE OF THE DAY 🐸:The God Emperor and his court JesterUSA and Canada 🇺🇲🇨🇦Not a drill: European Union banning memes (seriously).Dressed up for me best friend Melania.So Much Winning, STILL NOT TIRED OF IT!!As always, some tunes to get you jamming through this long list of winning;Ghost Town4th DimensionNo MistakesWatchWhat Would Meek do?MAGA ON PATRIOTS!Submitted June 09, 2018 at 11:48AM by Ivaginaryfriend https://www.reddit.com/The\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_Donald/comments/8ptnk6/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /The_DonaldSubmitted June 09, 2018 at 12:48PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pu2ln/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pun4d/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 06:13PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pwc8s/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 07:13PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pwpq2/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 08:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pxdfj/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 10:18PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pxu3a/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 11:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pydsj/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 12:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pynsafternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 02:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pz72afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 03:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pzfe1/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 06:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q02kv/afternoon\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 08:43AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q0jrp/afternoon\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 09:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q0s8t/afternoon\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 10:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q1bf2/afternoon\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 12:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q1y1t/afternoon\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q2m9o/afternoon\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 05:28PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q41fu/afternoon\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 06:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q4hwafternoon\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 08:23PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q57mj/afternoon\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 09:28PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q5lxs/afternoon\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 11:48PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q6hj6/afternoon\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 12:18AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q6o1m/afternoon\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\_your\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 01:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q71kt/afternoon\\\\\\\\\\\\_magathread\\\\\\\\\\\\_your\\\\\\\\\\\\_weekly\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 02:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q7hym/afternoon\\\\\\\\\\\_magathread\\\\\\\\\\\_your\\\\\\\\\\\_weekly\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 03:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q7sgi/afternoon\\\\\\\\\\_magathread\\\\\\\\\\_your\\\\\\\\\\_weekly\\\\\\\\\\_presidential/?utm\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 06:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q8lkv/afternoon\\\\\\\\\_magathread\\\\\\\\\_your\\\\\\\\\_weekly\\\\\\\\\_presidential/?utm\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 08:23AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q93tt/afternoon\\\\\\\\_magathread\\\\\\\\_your\\\\\\\\_weekly\\\\\\\\_presidential/?utm\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 09:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q9iv4/afternoon\\\\\\\_magathread\\\\\\\_your\\\\\\\_weekly\\\\\\\_presidential/?utm\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 10:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qa4xafternoon\\\\\\_magathread\\\\\\_your\\\\\\_weekly\\\\\\_presidential/?utm\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 12:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qavpx/afternoon\\\\\_magathread\\\\\_your\\\\\_weekly\\\\\_presidential/?utm\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qbjwj/afternoon\\\\_magathread\\\\_your\\\\_weekly\\\\_presidential/?utm\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 06:38PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qdrii/afternoon\\\_magathread\\\_your\\\_weekly\\\_presidential/?utm\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 08:23PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qehmo/afternoon\\_magathread\\_your\\_weekly\\_presidential/?utm\\_source=iftttvia /MagaFirstNews
Submitted June 11, 2018 at 09:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qf511/afternoon\_magathread\_your\_weekly\_presidential/?utm\_source=ifttt
via /MagaFirstNews
submitted by peterboykin to MagaFirstNews [link] [comments]


2018.06.12 03:58 peterboykin Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!

Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!
Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!HAPPPPPPY SATURDAY, PATRIOTS!This is your girl u/IvaginaryFriend back at it again with a weeks worth of spice for you lovely Deplorables! (◠‿◠✿)Before we officially get this recap started, if you happened to miss any past recaps you can catch them here!Also, don't forget about our Header contest coming up on Monday, June 11th!!! The winning submission will be proudly presented at the top of the DOM for the next few months!!!Now, let's get on with the show!Sunday, June 3rd:🔥🔥TRUMP TWEETS🔥🔥:Jesse Watters “The only thing Trump obstructed was Hillary getting to the White House.” So true!As only one of two people left who could become President, why wouldn’t the FBI or Department of “Justice” have told me that they were secretly investigating Paul Manafort (on charges that were 10 years old and had been previously dropped) during my campaign? Should have told me!....Paul Manafort came into the campaign very late and was with us for a short period of time (he represented Ronald Reagan, Bob Dole & many others over the years), but we should have been told that Comey and the boys were doing a number on him, and he wouldn’t have been hired!Mark Penn “Why are there people from the Clinton Foundation on the Mueller Staff? Why is there an Independent Counsel? To go after people and their families for unrelated offenses...Constitution was set up to prevent this...Stormtrooper tactics almost.” A disgrace!SIGNIFICANT TWEETS AND NEWS:WINNING! U.S. Beats Singapore & Hong Kong To Become The World's Most Competitive Economy Again - #MAGA!Roseanne Barr is off TV but Samantha Bee is still on -- just another example of the media’s double standardThis timeline is unexpected. In 2018, I have already skipped a Star Wars movie in the theatres and paid money for a Kanye West Album.THE MADMAN-Probably the best quote in human history to date🐸 TOP SPICE OF THE DAY 🐸:"oh they're so good, oh they're so sweet."Today is Trump's 500th day as POTUS so here is a commemorative $500 bill.This triggers leftists.FITTON: My first official meme for the TD"Cuz we hate him"Monday, June 4th:TODAY'S ACTION:Vice President Pence Delivers Remarks at a Reception Promoting a Hemisphere of FreedomPresident Donald J. Trump Announces Intent to Nominate Personnel to a Key Administration PostPresidential Memorandum for the Secretary of StatePresidential Memorandum for the Secretary of StateEight Nominations Sent to the Senate Today🔥🔥TRUMP TWEETS🔥🔥:This is my 500th. Day in Office and we have accomplished a lot - many believe more than any President in his first 500 days. Massive Tax & Regulation Cuts, Military & Vets, Lower Crime & Illegal Immigration, Stronger Borders, Judgeships, Best Economy & Jobs EVER, and much more... ....We had Repeal & Replace done (and the saving to our country of one trillion dollars) except for one person, but it is getting done anyway. Individual Mandate is gone and great, less expensive plans will be announced this month. Drug prices coming down & Right to Try!“This is the best time EVER to look for a job.” James Freeman of WSJ.As has been stated by numerous legal scholars, I have the absolute right to PARDON myself, but why would I do that when I have done nothing wrong? In the meantime, the never ending Witch Hunt, led by 13 very Angry and Conflicted Democrats (& others) continues into the mid-terms!China already charges a tax of 16% on soybeans. Canada has all sorts of trade barriers on our Agricultural products. Not acceptable!The U.S. has made such bad trade deals over so many years that we can only WIN!Farmers have not been doing well for 15 years. Mexico, Canada, China and others have treated them unfairly. By the time I finish trade talks, that will change. Big trade barriers against U.S. farmers, and other businesses, will finally be broken. Massive trade deficits no longer!The appointment of the Special Counsel is totally UNCONSTITUTIONAL! Despite that, we play the game because I, unlike the Democrats, have done nothing wrong!#500Days of American Greatness: http://45.wh.gov/gNWs8uThe Fake News Media is desperate to distract from the economy and record setting economic numbers and so they keep talking about the phony Russian Witch Hunt.In many ways this is the greatest economy in the HISTORY of America and the best time EVER to look for a job!Big Supreme Court ruling for Baker just out!The Philadelphia Eagles Football Team was invited to the White House. Unfortunately, only a small number of players decided to come, and we canceled the event. Staying in the Locker Room for the playing of our National Anthem is as disrespectful to our country as kneeling. Sorry!SIGNIFICANT TWEETS AND NEWS:Supreme Court rules 7-2 in favor of Colorado baker who refused to bake a wedding cake for a gay couple on religious grounds. SCOTUS finds that the Colorado Civil Rights Commission did not consider this case with religious neutrality and violated the Free Exercise Clause.Stand for the Anthem or don’t come. I love this President.Watch Bernie Sanders Run From Alex Jones At LAX Airport29 Years ago Today. This is Communism. Never Forget.The media was all about an outgoing Obama pardoning Incoming Hillary. Then they were cool with Hillary pardoning herself. But now, because it’s DJT, now it’s a “constitutional crisis.” Sorry ass complicit jerk-offs.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:worst boycott ever #MAGAJust saw this on another sub. Pretty accurate tbhThis is America.BREAKING: In a narrow 2,623-487 county decision, Trump wins the US electionBREAKING: In narrow 77-0 decision, Oklahoma goes entirely Republican.Tuesday, June 5th:TODAY'S ACTION:President Trump Participates in the Celebration of AmericaHerschel Walker at the White House Sports and Fitness DayNatalie Gulbis at the White House Sports and Fitness DayPresident Trump Participates in the Signing Ceremony for S. 292🔥🔥TRUMP TWEETS🔥🔥:What is taking so long with the Inspector General’s Report on Crooked Hillary and Slippery James Comey. Numerous delays. Hope Report is not being changed and made weaker! There are so many horrible things to tell, the public has the right to know. Transparency!The U.S. has an increased economic value of more than 7 Trillion Dollars since the Election. May be the best economy in the history of our country. Record Jobs numbers. Nice!We will proudly be playing the National Anthem and other wonderful music celebrating our Country today at 3 P.M., The White House, with the United States Marine Band and the United States Army Chorus. Honoring America! NFL, no escaping to Locker Rooms!We have had many Championship teams recently at the White House including the Chicago Cubs, Houston Astros, Pittsburgh Penguins, New England Patriots, Alabama and Clemson National Champions, and many others. National Anthem & more great music today at 3:00 P.M.The Russian Witch Hunt Hoax continues, all because Jeff Sessions didn’t tell me he was going to recuse himself...I would have quickly picked someone else. So much time and money wasted, so many lives ruined...and Sessions knew better than most that there was No Collusion!Meeting in Singapore with North Korea will hopefully be the start of something big...we will soon [email protected] and Champion @MartinTruex_Jr were recently at the White House. It was a great day for a great sport!Separating families at the Border is the fault of bad legislation passed by the Democrats. Border Security laws should be changed but the Dems can’t get their act together! Started the Wall.In High Tax, High Crime California, be sure to get out and vote for Republican John Cox for Governor. He will make a BIG difference!Get the vote out in California today for Rep. Kevin McCarthy and all of the great GOP candidates for Congress. Keep our country out of the hands of High Tax, High Crime Nancy Pelosi.Vote for Congressman Devin Nunes, a true American Patriot the likes of which we rarely see in our modern day world....he truly loves our country and deserves everyone’s support!Senator @RogerWicker of Mississippi has done everything necessary to Make America Great Again! Get out and vote for Roger, he has my total support!Terrific new book out by the wonderful Harris Faulkner, “9 Rules of Engagement.” Harris shares lessons from a military family. Enjoy!The HISTORIC Rescissions Package we’ve proposed would cut $15,000,000,000 in Wasteful Spending! We are getting our government back on track.Imagine how much wasteful spending we’d save if we didn’t have Chuck and Nancy standing in our way! For years, Democrats in Congress have depleted our military and busted our budgets on needless spending, and to what end? No more.Wow, Strzok-Page, the incompetent & corrupt FBI lovers, have texts referring to a counter-intelligence operation into the Trump Campaign dating way back to December, 2015. SPYGATE is in full force! Is the Mainstream Media interested yet? Big stuff!(Retweeting Robby Starbuck) Fox News has been #1 for 197 months straight. In the latest ratings disaster for CNN they lost another 25% of their viewers. Fox has 10 of the top 15 shows and even hold the #1 spot in the younger key demo. The public is loudly rejecting @CNN.(Retweeting Eric Trump) #MakeAmericaGreatAgain 🇺🇸🇺🇸🇺🇸(Retweeting Brad Parscale) Since the #FakeNews is full of distortions, underreporting, and lies, we launched a platform tonight presenting a comprehensive record of @realDonaldTrump’s administration. The truth will be told about a remarkable 500-day record of accomplishments!Great interview by @LouDobbs with Chris Farrell of Judicial Watch concerning the governments counter-intelligence operation into the Trump Campaign. SPYGATE at the highest level. Who would believe? 10,534 replies 12,776 retweets 50,227 likesChris Farrell, Judicial Watch. “They were running an operation to undermine a candidate for President of the U.S. These are all violations of law. This is intelligence tradecraft to steer an election. There’s nothing more grave when it comes to abuse of our intelligence system... ... ...This is a level of criminality beyond the pale. This is such a grave abuse of power and authority, it’s like nothing else we’ve seen in our history. This makes the Nixon Watergate burglary look like keystone cop stuff....The greatest Witch Hunt in political history!Mitch McConnell announced he will cancel the Senate’s August Recess. Great, maybe the Democrats will finally get something done other than their acceptance of High Crime and High Taxes. We need Border Security!SIGNIFICANT TWEETS AND NEWS:For the first time in recorded American history the U.S. Department of Labor reports: Job openings exceed number of job seekers. (That.... Mr Obama is a fucking magic wand)TRUMP ON MIDTERMS: WE CANNOT BE COMPLACENT. GET OUT AND VOTE AL, IA, MS, MT, NJ, NM & SD!!Page/Strokz emails including the changing of the verbiage to exhonerate ClintonAndrew McCabe seeks immunity for testimony in congressional hearingTHIS IS YUUUUUUGE:U.S. Senate Majority Leader Mitch McConnell canceled the Senate's traditional August recess, citing Democrats' "historic obstruction" to pass legislation.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:The Blue Wave. Proof. It's Happening. The Democrats are "unstoppable".Different kids of diets😂 This past weekend #Antifa came out to play in the Pacific Northwest and did they ever get a surprise!GeniusDon't let the world forget KateTfw the OIG is taking so long with the report on Crooked Hillary and Slippery James ComeyWednesday, June 6th:TODAY'S ACTION:President Trump Participates in the Signing Ceremony for S. 2372 – VA Mission Act of 2018President Trump Signs VA Mission Act of 2018 into LawPresident Trump and Vice President Pence Attend the 2018 Hurricane Briefing at FEMA HQPresident Trump Delivers Remarks After the 2018 Hurricane Briefing at FEMA HQPresident Trump Hosts the White House IFTARPresident Donald J. Trump Announces Intent to Nominate and Appoint Personnel to Key Administration PostsPresident Donald J. Trump Announces Appointments for the Executive Office of the President🔥🔥TRUMP TWEETS🔥🔥:Great night for Republicans! Congratulations to John Cox on a really big number in California. He can win. Even Fake News CNN said the Trump impact was really big, much bigger than they ever thought possible. So much for the big Blue Wave, it may be a big Red Wave. Working hard!Gold Star father, Ceejay Metcalf, whose great son Michael was just honored at the White House, was fantastic this morning on @foxandfriends. He is a special man!The Fake News Media has been so unfair, and vicious, to my wife and our great First Lady, Melania. During her recovery from surgery they reported everything from near death, to facelift, to left the W.H. (and me) for N.Y. or Virginia, to abuse. All Fake, she is doing really well!...Four reporters spotted Melania in the White House last week walking merrily along to a meeting. They never reported the sighting because it would hurt the sick narrative that she was living in a different part of the world, was really ill, or whatever. Fake News is really bad!Many more Republican voters showed up yesterday than the Fake News thought possible. The political pundits just don’t get what is going on out there - or they do get it but refuse to report the facts! Remember, Dems are High Tax, High Crime, easy to beat!Congratulations to Dana Rohrabacher on his big California win. We are proud of you Dana!Today we mark another milestone: the 74th anniversary of #DDay, the Allied invasion of Normandy. On June 6, 1944, more than 70,000 brave young Americans charged out of landing craft, jumped out of airplanes, and stormed into hell...We must always protect those who protect us. Today, it was my great honor to sign the #VAMissionAct and to make Veterans Choice the permanent law of the land! http://45.wh.gov/dyWJNqThank you to everyone at @FEMA HQ for today’s briefing on preparations for the upcoming hurricane season. Disaster response and recovery is best achieved when it’s federally supported, state managed, and locally executed – this is the successful model we will continue to build.SIGNIFICANT TWEETS AND NEWS:Seventy-four years ago today American patriots fought and died by the thousands to stop real fascism, racial genocide, and oppression. Let's remember these brave Americans who gave it all so Soy Boys today can claim every patriotic American is a fascist and racist without a hint of irony. D-Day 44Steve Scalise back on the field today.BOMBSHELL REPORT: The Obama administration granted a license letting Iran access the United States financial system despite officials’ pledges that they would prohibit itPromisesKept.com President Donald J. Trump's AccomplishmentsHenry Winkler says he was among 118,000 voters 'left off' Los Angeles County rosters Fox NewsThe Most Ignored Bombshell of 2017: Samantha Power was caught using her security clearance as a UN ambassador to review private conversations by U.S. citizens 260 times in the 2016 election year... She said that someone else in the Obama White House did this, using her security clearance.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:This is AmericaThe most important comment I've ever made. If this message resonates with even one person then I will have made the world a better place.Commander of CheeseheadsMiss America crowned in advance! Judges cite her YUGE brains and charity work with mentally impaired media as key factors! Beautiful person!Thursday, June 7th:TODAY'S ACTION:They Said It Couldn't Be DonePresident Trumps Meets with the Prime Minister of JapanPresident Trump Hosts a Joint Press Conference with the Prime Minister of JapanPresident Trump Welcomes Prime Minister Shinzō Abe of Japan to the White House[]()🔥🔥TRUMP TWEETS🔥🔥:Isn’t it Ironic? Getting ready to go to the G-7 in Canada to fight for our country on Trade (we have the worst trade deals ever made), then off to Singapore to meet with North Korea & the Nuclear Problem...But back home we still have the 13 Angry Democrats pushing the Witch Hunt!Good luck to Alice Johnson. Have a wonderful life!Alan Dershowitz, Harvard Law Professor: “It all proves that we never needed a Special Counsel....All of this could have been done by the Justice Dept. Don’t need a multi-million dollar group of people with a target on someone’s back. Not the way Justice should operate.” So true!When and where will all of the many conflicts of interest be listed by the 13 Angry Democrats (plus) working on the Witch Hunt Hoax. There has never been a group of people on a case so biased or conflicted. It is all a Democrat Excuse for LOSING the Election. Where is the server?How could Jeff Flake, who is setting record low polling numbers in Arizona and was therefore humiliatingly forced out of his own Senate seat without even a fight (and who doesn’t have a clue), think about running for office, even a lower one, again? Let’s face it, he’s a Flake!Looking forward to seeing my friend Prime Minister @AbeShinzo of Japan at noon. Will be discussing North Korea and Trade.Our Justice Department must not let Awan & Debbie Wasserman Schultz off the hook. The Democrat I.T. scandal is a key to much of the corruption we see today. They want to make a “plea deal” to hide what is on their Server. Where is Server? Really bad!When will people start saying, “thank you, Mr. President, for firing James Comey?”The Obama Administration is now accused of trying to give Iran secret access to the financial system of the United States. This is totally illegal. Perhaps we could get the 13 Angry Democrats to divert some of their energy to this “matter” (as Comey would call it). Investigate!“Total jobless claims running at lowest level in 44 years”“$3 billion payoff: 101 utilities cut rates, credit GOP tax cuts”MAKING AMERICA GREAT AGAIN!It’s my great honor to welcome Prime Minister @AbeShinzo back to the @WhiteHouse!🇺🇸🇯🇵Today, I am greatly honored to welcome my good friend, PM Abe of Japan to the @WhiteHouse. Over the past 16 months the Prime Minister and I have worked closely together to address common challenges, of which there are many...PM Abe and I are also working to improve the trading relationship between the U.S. and Japan, something we have to do. The U.S. seeks a bilateral deal with Japan that is based on the principle of fairness and reciprocity. We’re working hard to reduce our trade imbalance...Great day of meetings with Prime Minister @AbeShinzo of Japan!Please tell Prime Minister Trudeau and President Macron that they are charging the U.S. massive tariffs and create non-monetary barriers. The EU trade surplus with the U.S. is $151 Billion, and Canada keeps our farmers and others out. Look forward to seeing them tomorrow.Prime Minister Trudeau is being so indignant, bringing up the relationship that the U.S. and Canada had over the many years and all sorts of other things...but he doesn’t bring up the fact that they charge us up to 300% on dairy — hurting our Farmers, killing our Agriculture!Why isn’t the European Union and Canada informing the public that for years they have used massive Trade Tariffs and non-monetary Trade Barriers against the U.S. Totally unfair to our farmers, workers & companies. Take down your tariffs & barriers or we will more than match you!SIGNIFICANT TWEETS AND NEWS:OUTRAGEOUS! New IG Report - Social Security Benefits paid to DACA! Illegals are receiving OUR Social Security Benefits!The Kent State 2A girl is a god-tier shitposter.MSNBC Calls Daughter Of Pardoned Alice Johnson — She Can’t Stop Thanking TrumpTime Magazine honors Trump again!!! Beautiful cover. The left can’t meme.LOL! Sean Hannity is trending on Twitter because he jokingly told "witnesses" to smash their phones with hammers before handing them over to Mueller. Stupid Liberals are saying he is tampering with evidence. They probably dont know thats what Hillary actually did.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:This is AmericaGrandfather was born a slave, mother was born a refugee, I was born freeThere are only 2 genders, and if you disagree then you're an Islamophobe. Leftist SJWs BTFO!Mirror, Mirror on THE WALL, who's the WOKEST of us ALL??Friday, June 8th:TODAY'S ACTION:President Donald J. Trump Proclaims June 14, 2018 as Flag Day and the Week Starting June 10, 2018 as National Flag WeekPresident Trump Delivers a Statement Upon DeparturePresident Trump Participates in an Expanded Bilateral Meeting with the Prime Minister of CanadaPresident Trump Participates in a Bilateral Meeting with the President of the French Republic🔥🔥TRUMP TWEETS🔥🔥:Obama, Schumer and Pelosi did NOTHING about North Korea, and now weak on Crime, High Tax Schumer is telling me what to do at the Summit the Dems could never set up. Schumer failed with North Korea and Iran, we don’t need his advice!Canada charges the U.S. a 270% tariff on Dairy Products! They didn’t tell you that, did they? Not fair to our farmers!Looking forward to straightening out unfair Trade Deals with the G-7 countries. If it doesn’t happen, we come out even better!Congratulations to the Washington Capitals on their GREAT play and winning the Stanley Cup Championship. Alex Ovechkin, the team captain, was spectacular - a true Superstar! D.C. is popping, in many ways. What a time!I am heading for Canada and the G-7 for talks that will mostly center on the long time unfair trade practiced against the United States. From there I go to Singapore and talks with North Korea on Denuclearization. Won’t be talking about the Russian Witch Hunt Hoax for a while!My thoughts and prayers are with the families of our serviceman who was killed and his fellow servicemen who were wounded in Somalia. They are truly all HEROES.(Retweeting G7 Canada) Day 1 of #G7Charlevoix in 60 seconds.SIGNIFICANT TWEETS AND NEWS:President Trump confirms intent to sign states' rights cannabis bill that was introduced in Congress yesterdayPewdiepie reuploads video exposing CNN and Hillary Clinton after it got copystriked and deleted!BAHAHAHAHAHA.............BAHAJSJSKGLGOGICSteam refuses to bend the knee to SJWs, choosing to stand with community - All content that is legal will be allowed.BREAKING: Trump tells kneeling NFL players to recommend people to pardon, since that's what they're supposedly protesting. Their reason to kneel just died. LOL🐸 TOP SPICE OF THE DAY 🐸:When you're surrounded by globalistsPresstitutesHookers for Hillary, I should have known...ARCHIVE: "Sleeping with your source- especially a vindictive congressman?" - Ali Watkins, 2013Saturday, June 10th:TODAY'S ACTION:President Trump delivers a statementSIGNIFICANT TWEETS AND NEWS:Ali Watkins not getting the probe she had hoped for; Feds have seized her email and phone records for investigation on James Wolfe!HOLY SHIT Last night Bill Maher said what every lefitist truly thinks but might not say out loud: That he HOPES FOR A RECESSION to hurt President Trump. They'd rather see our country fail if it means Trump won't succeed. This is peak Trump derangement, folks. SAD!James Wolfe Leak Investigation: Journalists Insist on a Double Standard - Andrew McCarthyNew italian PM Conte on Facebook: Historic alliance, new friendship 🤝 - Can't get tired of all this winning, MAGA and MIGA!!! 🍝🍔BREAKING: Seth Rich's Brother's Attorneys Subpoena Twitter to Turn Over All Direct Messages from: Wikileaks, Julian Assange, KimDotCom, Cassandra Fairbanks, Gateway Pundit, etc🐸 TOP SPICE OF THE DAY 🐸:The God Emperor and his court JesterUSA and Canada 🇺🇲🇨🇦Not a drill: European Union banning memes (seriously).Dressed up for me best friend Melania.So Much Winning, STILL NOT TIRED OF IT!!As always, some tunes to get you jamming through this long list of winning;Ghost Town4th DimensionNo MistakesWatchWhat Would Meek do?MAGA ON PATRIOTS!Submitted June 09, 2018 at 11:48AM by Ivaginaryfriend https://www.reddit.com/The\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_Donald/comments/8ptnk6/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /The_DonaldSubmitted June 09, 2018 at 12:48PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pu2ln/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pun4d/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 06:13PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pwc8s/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 07:13PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pwpq2/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 08:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pxdfj/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 10:18PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pxu3a/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 11:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pydsj/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 12:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pynsafternoon\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 02:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pz72afternoon\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 03:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pzfe1/afternoon\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 06:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q02kv/afternoon\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 08:43AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q0jrp/afternoon\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 09:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q0s8t/afternoon\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 10:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q1bf2/afternoon\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 12:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q1y1t/afternoon\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q2m9o/afternoon\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 05:28PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q41fu/afternoon\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 06:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q4hwafternoon\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 08:23PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q57mj/afternoon\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 09:28PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q5lxs/afternoon\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 11:48PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q6hj6/afternoon\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\_your\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 12:18AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q6o1m/afternoon\\\\\\\\\\\\_magathread\\\\\\\\\\\\_your\\\\\\\\\\\\_weekly\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 01:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q71kt/afternoon\\\\\\\\\\\_magathread\\\\\\\\\\\_your\\\\\\\\\\\_weekly\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 02:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q7hym/afternoon\\\\\\\\\\_magathread\\\\\\\\\\_your\\\\\\\\\\_weekly\\\\\\\\\\_presidential/?utm\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 03:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q7sgi/afternoon\\\\\\\\\_magathread\\\\\\\\\_your\\\\\\\\\_weekly\\\\\\\\\_presidential/?utm\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 06:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q8lkv/afternoon\\\\\\\\_magathread\\\\\\\\_your\\\\\\\\_weekly\\\\\\\\_presidential/?utm\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 08:23AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q93tt/afternoon\\\\\\\_magathread\\\\\\\_your\\\\\\\_weekly\\\\\\\_presidential/?utm\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 09:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q9iv4/afternoon\\\\\\_magathread\\\\\\_your\\\\\\_weekly\\\\\\_presidential/?utm\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 10:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qa4xafternoon\\\\\_magathread\\\\\_your\\\\\_weekly\\\\\_presidential/?utm\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 12:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qavpx/afternoon\\\\_magathread\\\\_your\\\\_weekly\\\\_presidential/?utm\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qbjwj/afternoon\\\_magathread\\\_your\\\_weekly\\\_presidential/?utm\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 06:38PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qdrii/afternoon\\_magathread\\_your\\_weekly\\_presidential/?utm\\_source=iftttvia /MagaFirstNews
Submitted June 11, 2018 at 08:23PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qehmo/afternoon\_magathread\_your\_weekly\_presidential/?utm\_source=ifttt
via /MagaFirstNews
submitted by peterboykin to MagaFirstNews [link] [comments]


2018.06.12 02:23 peterboykin Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!

Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!
Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!HAPPPPPPY SATURDAY, PATRIOTS!This is your girl u/IvaginaryFriend back at it again with a weeks worth of spice for you lovely Deplorables! (◠‿◠✿)Before we officially get this recap started, if you happened to miss any past recaps you can catch them here!Also, don't forget about our Header contest coming up on Monday, June 11th!!! The winning submission will be proudly presented at the top of the DOM for the next few months!!!Now, let's get on with the show!Sunday, June 3rd:🔥🔥TRUMP TWEETS🔥🔥:Jesse Watters “The only thing Trump obstructed was Hillary getting to the White House.” So true!As only one of two people left who could become President, why wouldn’t the FBI or Department of “Justice” have told me that they were secretly investigating Paul Manafort (on charges that were 10 years old and had been previously dropped) during my campaign? Should have told me!....Paul Manafort came into the campaign very late and was with us for a short period of time (he represented Ronald Reagan, Bob Dole & many others over the years), but we should have been told that Comey and the boys were doing a number on him, and he wouldn’t have been hired!Mark Penn “Why are there people from the Clinton Foundation on the Mueller Staff? Why is there an Independent Counsel? To go after people and their families for unrelated offenses...Constitution was set up to prevent this...Stormtrooper tactics almost.” A disgrace!SIGNIFICANT TWEETS AND NEWS:WINNING! U.S. Beats Singapore & Hong Kong To Become The World's Most Competitive Economy Again - #MAGA!Roseanne Barr is off TV but Samantha Bee is still on -- just another example of the media’s double standardThis timeline is unexpected. In 2018, I have already skipped a Star Wars movie in the theatres and paid money for a Kanye West Album.THE MADMAN-Probably the best quote in human history to date🐸 TOP SPICE OF THE DAY 🐸:"oh they're so good, oh they're so sweet."Today is Trump's 500th day as POTUS so here is a commemorative $500 bill.This triggers leftists.FITTON: My first official meme for the TD"Cuz we hate him"Monday, June 4th:TODAY'S ACTION:Vice President Pence Delivers Remarks at a Reception Promoting a Hemisphere of FreedomPresident Donald J. Trump Announces Intent to Nominate Personnel to a Key Administration PostPresidential Memorandum for the Secretary of StatePresidential Memorandum for the Secretary of StateEight Nominations Sent to the Senate Today🔥🔥TRUMP TWEETS🔥🔥:This is my 500th. Day in Office and we have accomplished a lot - many believe more than any President in his first 500 days. Massive Tax & Regulation Cuts, Military & Vets, Lower Crime & Illegal Immigration, Stronger Borders, Judgeships, Best Economy & Jobs EVER, and much more... ....We had Repeal & Replace done (and the saving to our country of one trillion dollars) except for one person, but it is getting done anyway. Individual Mandate is gone and great, less expensive plans will be announced this month. Drug prices coming down & Right to Try!“This is the best time EVER to look for a job.” James Freeman of WSJ.As has been stated by numerous legal scholars, I have the absolute right to PARDON myself, but why would I do that when I have done nothing wrong? In the meantime, the never ending Witch Hunt, led by 13 very Angry and Conflicted Democrats (& others) continues into the mid-terms!China already charges a tax of 16% on soybeans. Canada has all sorts of trade barriers on our Agricultural products. Not acceptable!The U.S. has made such bad trade deals over so many years that we can only WIN!Farmers have not been doing well for 15 years. Mexico, Canada, China and others have treated them unfairly. By the time I finish trade talks, that will change. Big trade barriers against U.S. farmers, and other businesses, will finally be broken. Massive trade deficits no longer!The appointment of the Special Counsel is totally UNCONSTITUTIONAL! Despite that, we play the game because I, unlike the Democrats, have done nothing wrong!#500Days of American Greatness: http://45.wh.gov/gNWs8uThe Fake News Media is desperate to distract from the economy and record setting economic numbers and so they keep talking about the phony Russian Witch Hunt.In many ways this is the greatest economy in the HISTORY of America and the best time EVER to look for a job!Big Supreme Court ruling for Baker just out!The Philadelphia Eagles Football Team was invited to the White House. Unfortunately, only a small number of players decided to come, and we canceled the event. Staying in the Locker Room for the playing of our National Anthem is as disrespectful to our country as kneeling. Sorry!SIGNIFICANT TWEETS AND NEWS:Supreme Court rules 7-2 in favor of Colorado baker who refused to bake a wedding cake for a gay couple on religious grounds. SCOTUS finds that the Colorado Civil Rights Commission did not consider this case with religious neutrality and violated the Free Exercise Clause.Stand for the Anthem or don’t come. I love this President.Watch Bernie Sanders Run From Alex Jones At LAX Airport29 Years ago Today. This is Communism. Never Forget.The media was all about an outgoing Obama pardoning Incoming Hillary. Then they were cool with Hillary pardoning herself. But now, because it’s DJT, now it’s a “constitutional crisis.” Sorry ass complicit jerk-offs.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:worst boycott ever #MAGAJust saw this on another sub. Pretty accurate tbhThis is America.BREAKING: In a narrow 2,623-487 county decision, Trump wins the US electionBREAKING: In narrow 77-0 decision, Oklahoma goes entirely Republican.Tuesday, June 5th:TODAY'S ACTION:President Trump Participates in the Celebration of AmericaHerschel Walker at the White House Sports and Fitness DayNatalie Gulbis at the White House Sports and Fitness DayPresident Trump Participates in the Signing Ceremony for S. 292🔥🔥TRUMP TWEETS🔥🔥:What is taking so long with the Inspector General’s Report on Crooked Hillary and Slippery James Comey. Numerous delays. Hope Report is not being changed and made weaker! There are so many horrible things to tell, the public has the right to know. Transparency!The U.S. has an increased economic value of more than 7 Trillion Dollars since the Election. May be the best economy in the history of our country. Record Jobs numbers. Nice!We will proudly be playing the National Anthem and other wonderful music celebrating our Country today at 3 P.M., The White House, with the United States Marine Band and the United States Army Chorus. Honoring America! NFL, no escaping to Locker Rooms!We have had many Championship teams recently at the White House including the Chicago Cubs, Houston Astros, Pittsburgh Penguins, New England Patriots, Alabama and Clemson National Champions, and many others. National Anthem & more great music today at 3:00 P.M.The Russian Witch Hunt Hoax continues, all because Jeff Sessions didn’t tell me he was going to recuse himself...I would have quickly picked someone else. So much time and money wasted, so many lives ruined...and Sessions knew better than most that there was No Collusion!Meeting in Singapore with North Korea will hopefully be the start of something big...we will soon [email protected] and Champion @MartinTruex_Jr were recently at the White House. It was a great day for a great sport!Separating families at the Border is the fault of bad legislation passed by the Democrats. Border Security laws should be changed but the Dems can’t get their act together! Started the Wall.In High Tax, High Crime California, be sure to get out and vote for Republican John Cox for Governor. He will make a BIG difference!Get the vote out in California today for Rep. Kevin McCarthy and all of the great GOP candidates for Congress. Keep our country out of the hands of High Tax, High Crime Nancy Pelosi.Vote for Congressman Devin Nunes, a true American Patriot the likes of which we rarely see in our modern day world....he truly loves our country and deserves everyone’s support!Senator @RogerWicker of Mississippi has done everything necessary to Make America Great Again! Get out and vote for Roger, he has my total support!Terrific new book out by the wonderful Harris Faulkner, “9 Rules of Engagement.” Harris shares lessons from a military family. Enjoy!The HISTORIC Rescissions Package we’ve proposed would cut $15,000,000,000 in Wasteful Spending! We are getting our government back on track.Imagine how much wasteful spending we’d save if we didn’t have Chuck and Nancy standing in our way! For years, Democrats in Congress have depleted our military and busted our budgets on needless spending, and to what end? No more.Wow, Strzok-Page, the incompetent & corrupt FBI lovers, have texts referring to a counter-intelligence operation into the Trump Campaign dating way back to December, 2015. SPYGATE is in full force! Is the Mainstream Media interested yet? Big stuff!(Retweeting Robby Starbuck) Fox News has been #1 for 197 months straight. In the latest ratings disaster for CNN they lost another 25% of their viewers. Fox has 10 of the top 15 shows and even hold the #1 spot in the younger key demo. The public is loudly rejecting @CNN.(Retweeting Eric Trump) #MakeAmericaGreatAgain 🇺🇸🇺🇸🇺🇸(Retweeting Brad Parscale) Since the #FakeNews is full of distortions, underreporting, and lies, we launched a platform tonight presenting a comprehensive record of @realDonaldTrump’s administration. The truth will be told about a remarkable 500-day record of accomplishments!Great interview by @LouDobbs with Chris Farrell of Judicial Watch concerning the governments counter-intelligence operation into the Trump Campaign. SPYGATE at the highest level. Who would believe? 10,534 replies 12,776 retweets 50,227 likesChris Farrell, Judicial Watch. “They were running an operation to undermine a candidate for President of the U.S. These are all violations of law. This is intelligence tradecraft to steer an election. There’s nothing more grave when it comes to abuse of our intelligence system... ... ...This is a level of criminality beyond the pale. This is such a grave abuse of power and authority, it’s like nothing else we’ve seen in our history. This makes the Nixon Watergate burglary look like keystone cop stuff....The greatest Witch Hunt in political history!Mitch McConnell announced he will cancel the Senate’s August Recess. Great, maybe the Democrats will finally get something done other than their acceptance of High Crime and High Taxes. We need Border Security!SIGNIFICANT TWEETS AND NEWS:For the first time in recorded American history the U.S. Department of Labor reports: Job openings exceed number of job seekers. (That.... Mr Obama is a fucking magic wand)TRUMP ON MIDTERMS: WE CANNOT BE COMPLACENT. GET OUT AND VOTE AL, IA, MS, MT, NJ, NM & SD!!Page/Strokz emails including the changing of the verbiage to exhonerate ClintonAndrew McCabe seeks immunity for testimony in congressional hearingTHIS IS YUUUUUUGE:U.S. Senate Majority Leader Mitch McConnell canceled the Senate's traditional August recess, citing Democrats' "historic obstruction" to pass legislation.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:The Blue Wave. Proof. It's Happening. The Democrats are "unstoppable".Different kids of diets😂 This past weekend #Antifa came out to play in the Pacific Northwest and did they ever get a surprise!GeniusDon't let the world forget KateTfw the OIG is taking so long with the report on Crooked Hillary and Slippery James ComeyWednesday, June 6th:TODAY'S ACTION:President Trump Participates in the Signing Ceremony for S. 2372 – VA Mission Act of 2018President Trump Signs VA Mission Act of 2018 into LawPresident Trump and Vice President Pence Attend the 2018 Hurricane Briefing at FEMA HQPresident Trump Delivers Remarks After the 2018 Hurricane Briefing at FEMA HQPresident Trump Hosts the White House IFTARPresident Donald J. Trump Announces Intent to Nominate and Appoint Personnel to Key Administration PostsPresident Donald J. Trump Announces Appointments for the Executive Office of the President🔥🔥TRUMP TWEETS🔥🔥:Great night for Republicans! Congratulations to John Cox on a really big number in California. He can win. Even Fake News CNN said the Trump impact was really big, much bigger than they ever thought possible. So much for the big Blue Wave, it may be a big Red Wave. Working hard!Gold Star father, Ceejay Metcalf, whose great son Michael was just honored at the White House, was fantastic this morning on @foxandfriends. He is a special man!The Fake News Media has been so unfair, and vicious, to my wife and our great First Lady, Melania. During her recovery from surgery they reported everything from near death, to facelift, to left the W.H. (and me) for N.Y. or Virginia, to abuse. All Fake, she is doing really well!...Four reporters spotted Melania in the White House last week walking merrily along to a meeting. They never reported the sighting because it would hurt the sick narrative that she was living in a different part of the world, was really ill, or whatever. Fake News is really bad!Many more Republican voters showed up yesterday than the Fake News thought possible. The political pundits just don’t get what is going on out there - or they do get it but refuse to report the facts! Remember, Dems are High Tax, High Crime, easy to beat!Congratulations to Dana Rohrabacher on his big California win. We are proud of you Dana!Today we mark another milestone: the 74th anniversary of #DDay, the Allied invasion of Normandy. On June 6, 1944, more than 70,000 brave young Americans charged out of landing craft, jumped out of airplanes, and stormed into hell...We must always protect those who protect us. Today, it was my great honor to sign the #VAMissionAct and to make Veterans Choice the permanent law of the land! http://45.wh.gov/dyWJNqThank you to everyone at @FEMA HQ for today’s briefing on preparations for the upcoming hurricane season. Disaster response and recovery is best achieved when it’s federally supported, state managed, and locally executed – this is the successful model we will continue to build.SIGNIFICANT TWEETS AND NEWS:Seventy-four years ago today American patriots fought and died by the thousands to stop real fascism, racial genocide, and oppression. Let's remember these brave Americans who gave it all so Soy Boys today can claim every patriotic American is a fascist and racist without a hint of irony. D-Day 44Steve Scalise back on the field today.BOMBSHELL REPORT: The Obama administration granted a license letting Iran access the United States financial system despite officials’ pledges that they would prohibit itPromisesKept.com President Donald J. Trump's AccomplishmentsHenry Winkler says he was among 118,000 voters 'left off' Los Angeles County rosters Fox NewsThe Most Ignored Bombshell of 2017: Samantha Power was caught using her security clearance as a UN ambassador to review private conversations by U.S. citizens 260 times in the 2016 election year... She said that someone else in the Obama White House did this, using her security clearance.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:This is AmericaThe most important comment I've ever made. If this message resonates with even one person then I will have made the world a better place.Commander of CheeseheadsMiss America crowned in advance! Judges cite her YUGE brains and charity work with mentally impaired media as key factors! Beautiful person!Thursday, June 7th:TODAY'S ACTION:They Said It Couldn't Be DonePresident Trumps Meets with the Prime Minister of JapanPresident Trump Hosts a Joint Press Conference with the Prime Minister of JapanPresident Trump Welcomes Prime Minister Shinzō Abe of Japan to the White House[]()🔥🔥TRUMP TWEETS🔥🔥:Isn’t it Ironic? Getting ready to go to the G-7 in Canada to fight for our country on Trade (we have the worst trade deals ever made), then off to Singapore to meet with North Korea & the Nuclear Problem...But back home we still have the 13 Angry Democrats pushing the Witch Hunt!Good luck to Alice Johnson. Have a wonderful life!Alan Dershowitz, Harvard Law Professor: “It all proves that we never needed a Special Counsel....All of this could have been done by the Justice Dept. Don’t need a multi-million dollar group of people with a target on someone’s back. Not the way Justice should operate.” So true!When and where will all of the many conflicts of interest be listed by the 13 Angry Democrats (plus) working on the Witch Hunt Hoax. There has never been a group of people on a case so biased or conflicted. It is all a Democrat Excuse for LOSING the Election. Where is the server?How could Jeff Flake, who is setting record low polling numbers in Arizona and was therefore humiliatingly forced out of his own Senate seat without even a fight (and who doesn’t have a clue), think about running for office, even a lower one, again? Let’s face it, he’s a Flake!Looking forward to seeing my friend Prime Minister @AbeShinzo of Japan at noon. Will be discussing North Korea and Trade.Our Justice Department must not let Awan & Debbie Wasserman Schultz off the hook. The Democrat I.T. scandal is a key to much of the corruption we see today. They want to make a “plea deal” to hide what is on their Server. Where is Server? Really bad!When will people start saying, “thank you, Mr. President, for firing James Comey?”The Obama Administration is now accused of trying to give Iran secret access to the financial system of the United States. This is totally illegal. Perhaps we could get the 13 Angry Democrats to divert some of their energy to this “matter” (as Comey would call it). Investigate!“Total jobless claims running at lowest level in 44 years”“$3 billion payoff: 101 utilities cut rates, credit GOP tax cuts”MAKING AMERICA GREAT AGAIN!It’s my great honor to welcome Prime Minister @AbeShinzo back to the @WhiteHouse!🇺🇸🇯🇵Today, I am greatly honored to welcome my good friend, PM Abe of Japan to the @WhiteHouse. Over the past 16 months the Prime Minister and I have worked closely together to address common challenges, of which there are many...PM Abe and I are also working to improve the trading relationship between the U.S. and Japan, something we have to do. The U.S. seeks a bilateral deal with Japan that is based on the principle of fairness and reciprocity. We’re working hard to reduce our trade imbalance...Great day of meetings with Prime Minister @AbeShinzo of Japan!Please tell Prime Minister Trudeau and President Macron that they are charging the U.S. massive tariffs and create non-monetary barriers. The EU trade surplus with the U.S. is $151 Billion, and Canada keeps our farmers and others out. Look forward to seeing them tomorrow.Prime Minister Trudeau is being so indignant, bringing up the relationship that the U.S. and Canada had over the many years and all sorts of other things...but he doesn’t bring up the fact that they charge us up to 300% on dairy — hurting our Farmers, killing our Agriculture!Why isn’t the European Union and Canada informing the public that for years they have used massive Trade Tariffs and non-monetary Trade Barriers against the U.S. Totally unfair to our farmers, workers & companies. Take down your tariffs & barriers or we will more than match you!SIGNIFICANT TWEETS AND NEWS:OUTRAGEOUS! New IG Report - Social Security Benefits paid to DACA! Illegals are receiving OUR Social Security Benefits!The Kent State 2A girl is a god-tier shitposter.MSNBC Calls Daughter Of Pardoned Alice Johnson — She Can’t Stop Thanking TrumpTime Magazine honors Trump again!!! Beautiful cover. The left can’t meme.LOL! Sean Hannity is trending on Twitter because he jokingly told "witnesses" to smash their phones with hammers before handing them over to Mueller. Stupid Liberals are saying he is tampering with evidence. They probably dont know thats what Hillary actually did.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:This is AmericaGrandfather was born a slave, mother was born a refugee, I was born freeThere are only 2 genders, and if you disagree then you're an Islamophobe. Leftist SJWs BTFO!Mirror, Mirror on THE WALL, who's the WOKEST of us ALL??Friday, June 8th:TODAY'S ACTION:President Donald J. Trump Proclaims June 14, 2018 as Flag Day and the Week Starting June 10, 2018 as National Flag WeekPresident Trump Delivers a Statement Upon DeparturePresident Trump Participates in an Expanded Bilateral Meeting with the Prime Minister of CanadaPresident Trump Participates in a Bilateral Meeting with the President of the French Republic🔥🔥TRUMP TWEETS🔥🔥:Obama, Schumer and Pelosi did NOTHING about North Korea, and now weak on Crime, High Tax Schumer is telling me what to do at the Summit the Dems could never set up. Schumer failed with North Korea and Iran, we don’t need his advice!Canada charges the U.S. a 270% tariff on Dairy Products! They didn’t tell you that, did they? Not fair to our farmers!Looking forward to straightening out unfair Trade Deals with the G-7 countries. If it doesn’t happen, we come out even better!Congratulations to the Washington Capitals on their GREAT play and winning the Stanley Cup Championship. Alex Ovechkin, the team captain, was spectacular - a true Superstar! D.C. is popping, in many ways. What a time!I am heading for Canada and the G-7 for talks that will mostly center on the long time unfair trade practiced against the United States. From there I go to Singapore and talks with North Korea on Denuclearization. Won’t be talking about the Russian Witch Hunt Hoax for a while!My thoughts and prayers are with the families of our serviceman who was killed and his fellow servicemen who were wounded in Somalia. They are truly all HEROES.(Retweeting G7 Canada) Day 1 of #G7Charlevoix in 60 seconds.SIGNIFICANT TWEETS AND NEWS:President Trump confirms intent to sign states' rights cannabis bill that was introduced in Congress yesterdayPewdiepie reuploads video exposing CNN and Hillary Clinton after it got copystriked and deleted!BAHAHAHAHAHA.............BAHAJSJSKGLGOGICSteam refuses to bend the knee to SJWs, choosing to stand with community - All content that is legal will be allowed.BREAKING: Trump tells kneeling NFL players to recommend people to pardon, since that's what they're supposedly protesting. Their reason to kneel just died. LOL🐸 TOP SPICE OF THE DAY 🐸:When you're surrounded by globalistsPresstitutesHookers for Hillary, I should have known...ARCHIVE: "Sleeping with your source- especially a vindictive congressman?" - Ali Watkins, 2013Saturday, June 10th:TODAY'S ACTION:President Trump delivers a statementSIGNIFICANT TWEETS AND NEWS:Ali Watkins not getting the probe she had hoped for; Feds have seized her email and phone records for investigation on James Wolfe!HOLY SHIT Last night Bill Maher said what every lefitist truly thinks but might not say out loud: That he HOPES FOR A RECESSION to hurt President Trump. They'd rather see our country fail if it means Trump won't succeed. This is peak Trump derangement, folks. SAD!James Wolfe Leak Investigation: Journalists Insist on a Double Standard - Andrew McCarthyNew italian PM Conte on Facebook: Historic alliance, new friendship 🤝 - Can't get tired of all this winning, MAGA and MIGA!!! 🍝🍔BREAKING: Seth Rich's Brother's Attorneys Subpoena Twitter to Turn Over All Direct Messages from: Wikileaks, Julian Assange, KimDotCom, Cassandra Fairbanks, Gateway Pundit, etc🐸 TOP SPICE OF THE DAY 🐸:The God Emperor and his court JesterUSA and Canada 🇺🇲🇨🇦Not a drill: European Union banning memes (seriously).Dressed up for me best friend Melania.So Much Winning, STILL NOT TIRED OF IT!!As always, some tunes to get you jamming through this long list of winning;Ghost Town4th DimensionNo MistakesWatchWhat Would Meek do?MAGA ON PATRIOTS!Submitted June 09, 2018 at 11:48AM by Ivaginaryfriend https://www.reddit.com/The\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_Donald/comments/8ptnk6/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /The_DonaldSubmitted June 09, 2018 at 12:48PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pu2ln/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pun4d/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 06:13PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pwc8s/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 07:13PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pwpq2/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 08:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pxdfj/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 10:18PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pxu3a/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 11:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pydsj/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 12:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pynsafternoon\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 02:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pz72afternoon\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 03:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pzfe1/afternoon\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 06:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q02kv/afternoon\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 08:43AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q0jrp/afternoon\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 09:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q0s8t/afternoon\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 10:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q1bf2/afternoon\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 12:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q1y1t/afternoon\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q2m9o/afternoon\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 05:28PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q41fu/afternoon\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 06:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q4hwafternoon\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 08:23PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q57mj/afternoon\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 09:28PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q5lxs/afternoon\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\_your\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 11:48PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q6hj6/afternoon\\\\\\\\\\\\_magathread\\\\\\\\\\\\_your\\\\\\\\\\\\_weekly\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 12:18AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q6o1m/afternoon\\\\\\\\\\\_magathread\\\\\\\\\\\_your\\\\\\\\\\\_weekly\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 01:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q71kt/afternoon\\\\\\\\\\_magathread\\\\\\\\\\_your\\\\\\\\\\_weekly\\\\\\\\\\_presidential/?utm\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 02:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q7hym/afternoon\\\\\\\\\_magathread\\\\\\\\\_your\\\\\\\\\_weekly\\\\\\\\\_presidential/?utm\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 03:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q7sgi/afternoon\\\\\\\\_magathread\\\\\\\\_your\\\\\\\\_weekly\\\\\\\\_presidential/?utm\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 06:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q8lkv/afternoon\\\\\\\_magathread\\\\\\\_your\\\\\\\_weekly\\\\\\\_presidential/?utm\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 08:23AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q93tt/afternoon\\\\\\_magathread\\\\\\_your\\\\\\_weekly\\\\\\_presidential/?utm\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 09:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q9iv4/afternoon\\\\\_magathread\\\\\_your\\\\\_weekly\\\\\_presidential/?utm\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 10:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qa4xafternoon\\\\_magathread\\\\_your\\\\_weekly\\\\_presidential/?utm\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 12:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qavpx/afternoon\\\_magathread\\\_your\\\_weekly\\\_presidential/?utm\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qbjwj/afternoon\\_magathread\\_your\\_weekly\\_presidential/?utm\\_source=iftttvia /MagaFirstNews
Submitted June 11, 2018 at 06:38PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qdrii/afternoon\_magathread\_your\_weekly\_presidential/?utm\_source=ifttt
via /MagaFirstNews
submitted by peterboykin to MagaFirstNews [link] [comments]


2018.06.12 00:38 peterboykin Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!

Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!
Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!Afternoon MAGAthread: YOUR WEEKLY PRESIDENTIAL RECAP!HAPPPPPPY SATURDAY, PATRIOTS!This is your girl u/IvaginaryFriend back at it again with a weeks worth of spice for you lovely Deplorables! (◠‿◠✿)Before we officially get this recap started, if you happened to miss any past recaps you can catch them here!Also, don't forget about our Header contest coming up on Monday, June 11th!!! The winning submission will be proudly presented at the top of the DOM for the next few months!!!Now, let's get on with the show!Sunday, June 3rd:🔥🔥TRUMP TWEETS🔥🔥:Jesse Watters “The only thing Trump obstructed was Hillary getting to the White House.” So true!As only one of two people left who could become President, why wouldn’t the FBI or Department of “Justice” have told me that they were secretly investigating Paul Manafort (on charges that were 10 years old and had been previously dropped) during my campaign? Should have told me!....Paul Manafort came into the campaign very late and was with us for a short period of time (he represented Ronald Reagan, Bob Dole & many others over the years), but we should have been told that Comey and the boys were doing a number on him, and he wouldn’t have been hired!Mark Penn “Why are there people from the Clinton Foundation on the Mueller Staff? Why is there an Independent Counsel? To go after people and their families for unrelated offenses...Constitution was set up to prevent this...Stormtrooper tactics almost.” A disgrace!SIGNIFICANT TWEETS AND NEWS:WINNING! U.S. Beats Singapore & Hong Kong To Become The World's Most Competitive Economy Again - #MAGA!Roseanne Barr is off TV but Samantha Bee is still on -- just another example of the media’s double standardThis timeline is unexpected. In 2018, I have already skipped a Star Wars movie in the theatres and paid money for a Kanye West Album.THE MADMAN-Probably the best quote in human history to date🐸 TOP SPICE OF THE DAY 🐸:"oh they're so good, oh they're so sweet."Today is Trump's 500th day as POTUS so here is a commemorative $500 bill.This triggers leftists.FITTON: My first official meme for the TD"Cuz we hate him"Monday, June 4th:TODAY'S ACTION:Vice President Pence Delivers Remarks at a Reception Promoting a Hemisphere of FreedomPresident Donald J. Trump Announces Intent to Nominate Personnel to a Key Administration PostPresidential Memorandum for the Secretary of StatePresidential Memorandum for the Secretary of StateEight Nominations Sent to the Senate Today🔥🔥TRUMP TWEETS🔥🔥:This is my 500th. Day in Office and we have accomplished a lot - many believe more than any President in his first 500 days. Massive Tax & Regulation Cuts, Military & Vets, Lower Crime & Illegal Immigration, Stronger Borders, Judgeships, Best Economy & Jobs EVER, and much more... ....We had Repeal & Replace done (and the saving to our country of one trillion dollars) except for one person, but it is getting done anyway. Individual Mandate is gone and great, less expensive plans will be announced this month. Drug prices coming down & Right to Try!“This is the best time EVER to look for a job.” James Freeman of WSJ.As has been stated by numerous legal scholars, I have the absolute right to PARDON myself, but why would I do that when I have done nothing wrong? In the meantime, the never ending Witch Hunt, led by 13 very Angry and Conflicted Democrats (& others) continues into the mid-terms!China already charges a tax of 16% on soybeans. Canada has all sorts of trade barriers on our Agricultural products. Not acceptable!The U.S. has made such bad trade deals over so many years that we can only WIN!Farmers have not been doing well for 15 years. Mexico, Canada, China and others have treated them unfairly. By the time I finish trade talks, that will change. Big trade barriers against U.S. farmers, and other businesses, will finally be broken. Massive trade deficits no longer!The appointment of the Special Counsel is totally UNCONSTITUTIONAL! Despite that, we play the game because I, unlike the Democrats, have done nothing wrong!#500Days of American Greatness: http://45.wh.gov/gNWs8uThe Fake News Media is desperate to distract from the economy and record setting economic numbers and so they keep talking about the phony Russian Witch Hunt.In many ways this is the greatest economy in the HISTORY of America and the best time EVER to look for a job!Big Supreme Court ruling for Baker just out!The Philadelphia Eagles Football Team was invited to the White House. Unfortunately, only a small number of players decided to come, and we canceled the event. Staying in the Locker Room for the playing of our National Anthem is as disrespectful to our country as kneeling. Sorry!SIGNIFICANT TWEETS AND NEWS:Supreme Court rules 7-2 in favor of Colorado baker who refused to bake a wedding cake for a gay couple on religious grounds. SCOTUS finds that the Colorado Civil Rights Commission did not consider this case with religious neutrality and violated the Free Exercise Clause.Stand for the Anthem or don’t come. I love this President.Watch Bernie Sanders Run From Alex Jones At LAX Airport29 Years ago Today. This is Communism. Never Forget.The media was all about an outgoing Obama pardoning Incoming Hillary. Then they were cool with Hillary pardoning herself. But now, because it’s DJT, now it’s a “constitutional crisis.” Sorry ass complicit jerk-offs.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:worst boycott ever #MAGAJust saw this on another sub. Pretty accurate tbhThis is America.BREAKING: In a narrow 2,623-487 county decision, Trump wins the US electionBREAKING: In narrow 77-0 decision, Oklahoma goes entirely Republican.Tuesday, June 5th:TODAY'S ACTION:President Trump Participates in the Celebration of AmericaHerschel Walker at the White House Sports and Fitness DayNatalie Gulbis at the White House Sports and Fitness DayPresident Trump Participates in the Signing Ceremony for S. 292🔥🔥TRUMP TWEETS🔥🔥:What is taking so long with the Inspector General’s Report on Crooked Hillary and Slippery James Comey. Numerous delays. Hope Report is not being changed and made weaker! There are so many horrible things to tell, the public has the right to know. Transparency!The U.S. has an increased economic value of more than 7 Trillion Dollars since the Election. May be the best economy in the history of our country. Record Jobs numbers. Nice!We will proudly be playing the National Anthem and other wonderful music celebrating our Country today at 3 P.M., The White House, with the United States Marine Band and the United States Army Chorus. Honoring America! NFL, no escaping to Locker Rooms!We have had many Championship teams recently at the White House including the Chicago Cubs, Houston Astros, Pittsburgh Penguins, New England Patriots, Alabama and Clemson National Champions, and many others. National Anthem & more great music today at 3:00 P.M.The Russian Witch Hunt Hoax continues, all because Jeff Sessions didn’t tell me he was going to recuse himself...I would have quickly picked someone else. So much time and money wasted, so many lives ruined...and Sessions knew better than most that there was No Collusion!Meeting in Singapore with North Korea will hopefully be the start of something big...we will soon [email protected] and Champion @MartinTruex_Jr were recently at the White House. It was a great day for a great sport!Separating families at the Border is the fault of bad legislation passed by the Democrats. Border Security laws should be changed but the Dems can’t get their act together! Started the Wall.In High Tax, High Crime California, be sure to get out and vote for Republican John Cox for Governor. He will make a BIG difference!Get the vote out in California today for Rep. Kevin McCarthy and all of the great GOP candidates for Congress. Keep our country out of the hands of High Tax, High Crime Nancy Pelosi.Vote for Congressman Devin Nunes, a true American Patriot the likes of which we rarely see in our modern day world....he truly loves our country and deserves everyone’s support!Senator @RogerWicker of Mississippi has done everything necessary to Make America Great Again! Get out and vote for Roger, he has my total support!Terrific new book out by the wonderful Harris Faulkner, “9 Rules of Engagement.” Harris shares lessons from a military family. Enjoy!The HISTORIC Rescissions Package we’ve proposed would cut $15,000,000,000 in Wasteful Spending! We are getting our government back on track.Imagine how much wasteful spending we’d save if we didn’t have Chuck and Nancy standing in our way! For years, Democrats in Congress have depleted our military and busted our budgets on needless spending, and to what end? No more.Wow, Strzok-Page, the incompetent & corrupt FBI lovers, have texts referring to a counter-intelligence operation into the Trump Campaign dating way back to December, 2015. SPYGATE is in full force! Is the Mainstream Media interested yet? Big stuff!(Retweeting Robby Starbuck) Fox News has been #1 for 197 months straight. In the latest ratings disaster for CNN they lost another 25% of their viewers. Fox has 10 of the top 15 shows and even hold the #1 spot in the younger key demo. The public is loudly rejecting @CNN.(Retweeting Eric Trump) #MakeAmericaGreatAgain 🇺🇸🇺🇸🇺🇸(Retweeting Brad Parscale) Since the #FakeNews is full of distortions, underreporting, and lies, we launched a platform tonight presenting a comprehensive record of @realDonaldTrump’s administration. The truth will be told about a remarkable 500-day record of accomplishments!Great interview by @LouDobbs with Chris Farrell of Judicial Watch concerning the governments counter-intelligence operation into the Trump Campaign. SPYGATE at the highest level. Who would believe? 10,534 replies 12,776 retweets 50,227 likesChris Farrell, Judicial Watch. “They were running an operation to undermine a candidate for President of the U.S. These are all violations of law. This is intelligence tradecraft to steer an election. There’s nothing more grave when it comes to abuse of our intelligence system... ... ...This is a level of criminality beyond the pale. This is such a grave abuse of power and authority, it’s like nothing else we’ve seen in our history. This makes the Nixon Watergate burglary look like keystone cop stuff....The greatest Witch Hunt in political history!Mitch McConnell announced he will cancel the Senate’s August Recess. Great, maybe the Democrats will finally get something done other than their acceptance of High Crime and High Taxes. We need Border Security!SIGNIFICANT TWEETS AND NEWS:For the first time in recorded American history the U.S. Department of Labor reports: Job openings exceed number of job seekers. (That.... Mr Obama is a fucking magic wand)TRUMP ON MIDTERMS: WE CANNOT BE COMPLACENT. GET OUT AND VOTE AL, IA, MS, MT, NJ, NM & SD!!Page/Strokz emails including the changing of the verbiage to exhonerate ClintonAndrew McCabe seeks immunity for testimony in congressional hearingTHIS IS YUUUUUUGE:U.S. Senate Majority Leader Mitch McConnell canceled the Senate's traditional August recess, citing Democrats' "historic obstruction" to pass legislation.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:The Blue Wave. Proof. It's Happening. The Democrats are "unstoppable".Different kids of diets😂 This past weekend #Antifa came out to play in the Pacific Northwest and did they ever get a surprise!GeniusDon't let the world forget KateTfw the OIG is taking so long with the report on Crooked Hillary and Slippery James ComeyWednesday, June 6th:TODAY'S ACTION:President Trump Participates in the Signing Ceremony for S. 2372 – VA Mission Act of 2018President Trump Signs VA Mission Act of 2018 into LawPresident Trump and Vice President Pence Attend the 2018 Hurricane Briefing at FEMA HQPresident Trump Delivers Remarks After the 2018 Hurricane Briefing at FEMA HQPresident Trump Hosts the White House IFTARPresident Donald J. Trump Announces Intent to Nominate and Appoint Personnel to Key Administration PostsPresident Donald J. Trump Announces Appointments for the Executive Office of the President🔥🔥TRUMP TWEETS🔥🔥:Great night for Republicans! Congratulations to John Cox on a really big number in California. He can win. Even Fake News CNN said the Trump impact was really big, much bigger than they ever thought possible. So much for the big Blue Wave, it may be a big Red Wave. Working hard!Gold Star father, Ceejay Metcalf, whose great son Michael was just honored at the White House, was fantastic this morning on @foxandfriends. He is a special man!The Fake News Media has been so unfair, and vicious, to my wife and our great First Lady, Melania. During her recovery from surgery they reported everything from near death, to facelift, to left the W.H. (and me) for N.Y. or Virginia, to abuse. All Fake, she is doing really well!...Four reporters spotted Melania in the White House last week walking merrily along to a meeting. They never reported the sighting because it would hurt the sick narrative that she was living in a different part of the world, was really ill, or whatever. Fake News is really bad!Many more Republican voters showed up yesterday than the Fake News thought possible. The political pundits just don’t get what is going on out there - or they do get it but refuse to report the facts! Remember, Dems are High Tax, High Crime, easy to beat!Congratulations to Dana Rohrabacher on his big California win. We are proud of you Dana!Today we mark another milestone: the 74th anniversary of #DDay, the Allied invasion of Normandy. On June 6, 1944, more than 70,000 brave young Americans charged out of landing craft, jumped out of airplanes, and stormed into hell...We must always protect those who protect us. Today, it was my great honor to sign the #VAMissionAct and to make Veterans Choice the permanent law of the land! http://45.wh.gov/dyWJNqThank you to everyone at @FEMA HQ for today’s briefing on preparations for the upcoming hurricane season. Disaster response and recovery is best achieved when it’s federally supported, state managed, and locally executed – this is the successful model we will continue to build.SIGNIFICANT TWEETS AND NEWS:Seventy-four years ago today American patriots fought and died by the thousands to stop real fascism, racial genocide, and oppression. Let's remember these brave Americans who gave it all so Soy Boys today can claim every patriotic American is a fascist and racist without a hint of irony. D-Day 44Steve Scalise back on the field today.BOMBSHELL REPORT: The Obama administration granted a license letting Iran access the United States financial system despite officials’ pledges that they would prohibit itPromisesKept.com President Donald J. Trump's AccomplishmentsHenry Winkler says he was among 118,000 voters 'left off' Los Angeles County rosters Fox NewsThe Most Ignored Bombshell of 2017: Samantha Power was caught using her security clearance as a UN ambassador to review private conversations by U.S. citizens 260 times in the 2016 election year... She said that someone else in the Obama White House did this, using her security clearance.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:This is AmericaThe most important comment I've ever made. If this message resonates with even one person then I will have made the world a better place.Commander of CheeseheadsMiss America crowned in advance! Judges cite her YUGE brains and charity work with mentally impaired media as key factors! Beautiful person!Thursday, June 7th:TODAY'S ACTION:They Said It Couldn't Be DonePresident Trumps Meets with the Prime Minister of JapanPresident Trump Hosts a Joint Press Conference with the Prime Minister of JapanPresident Trump Welcomes Prime Minister Shinzō Abe of Japan to the White House[]()🔥🔥TRUMP TWEETS🔥🔥:Isn’t it Ironic? Getting ready to go to the G-7 in Canada to fight for our country on Trade (we have the worst trade deals ever made), then off to Singapore to meet with North Korea & the Nuclear Problem...But back home we still have the 13 Angry Democrats pushing the Witch Hunt!Good luck to Alice Johnson. Have a wonderful life!Alan Dershowitz, Harvard Law Professor: “It all proves that we never needed a Special Counsel....All of this could have been done by the Justice Dept. Don’t need a multi-million dollar group of people with a target on someone’s back. Not the way Justice should operate.” So true!When and where will all of the many conflicts of interest be listed by the 13 Angry Democrats (plus) working on the Witch Hunt Hoax. There has never been a group of people on a case so biased or conflicted. It is all a Democrat Excuse for LOSING the Election. Where is the server?How could Jeff Flake, who is setting record low polling numbers in Arizona and was therefore humiliatingly forced out of his own Senate seat without even a fight (and who doesn’t have a clue), think about running for office, even a lower one, again? Let’s face it, he’s a Flake!Looking forward to seeing my friend Prime Minister @AbeShinzo of Japan at noon. Will be discussing North Korea and Trade.Our Justice Department must not let Awan & Debbie Wasserman Schultz off the hook. The Democrat I.T. scandal is a key to much of the corruption we see today. They want to make a “plea deal” to hide what is on their Server. Where is Server? Really bad!When will people start saying, “thank you, Mr. President, for firing James Comey?”The Obama Administration is now accused of trying to give Iran secret access to the financial system of the United States. This is totally illegal. Perhaps we could get the 13 Angry Democrats to divert some of their energy to this “matter” (as Comey would call it). Investigate!“Total jobless claims running at lowest level in 44 years”“$3 billion payoff: 101 utilities cut rates, credit GOP tax cuts”MAKING AMERICA GREAT AGAIN!It’s my great honor to welcome Prime Minister @AbeShinzo back to the @WhiteHouse!🇺🇸🇯🇵Today, I am greatly honored to welcome my good friend, PM Abe of Japan to the @WhiteHouse. Over the past 16 months the Prime Minister and I have worked closely together to address common challenges, of which there are many...PM Abe and I are also working to improve the trading relationship between the U.S. and Japan, something we have to do. The U.S. seeks a bilateral deal with Japan that is based on the principle of fairness and reciprocity. We’re working hard to reduce our trade imbalance...Great day of meetings with Prime Minister @AbeShinzo of Japan!Please tell Prime Minister Trudeau and President Macron that they are charging the U.S. massive tariffs and create non-monetary barriers. The EU trade surplus with the U.S. is $151 Billion, and Canada keeps our farmers and others out. Look forward to seeing them tomorrow.Prime Minister Trudeau is being so indignant, bringing up the relationship that the U.S. and Canada had over the many years and all sorts of other things...but he doesn’t bring up the fact that they charge us up to 300% on dairy — hurting our Farmers, killing our Agriculture!Why isn’t the European Union and Canada informing the public that for years they have used massive Trade Tariffs and non-monetary Trade Barriers against the U.S. Totally unfair to our farmers, workers & companies. Take down your tariffs & barriers or we will more than match you!SIGNIFICANT TWEETS AND NEWS:OUTRAGEOUS! New IG Report - Social Security Benefits paid to DACA! Illegals are receiving OUR Social Security Benefits!The Kent State 2A girl is a god-tier shitposter.MSNBC Calls Daughter Of Pardoned Alice Johnson — She Can’t Stop Thanking TrumpTime Magazine honors Trump again!!! Beautiful cover. The left can’t meme.LOL! Sean Hannity is trending on Twitter because he jokingly told "witnesses" to smash their phones with hammers before handing them over to Mueller. Stupid Liberals are saying he is tampering with evidence. They probably dont know thats what Hillary actually did.PRESS BRIEFINGS, INTERVIEWS, RALLIES:Press Beating🐸 TOP SPICE OF THE DAY 🐸:This is AmericaGrandfather was born a slave, mother was born a refugee, I was born freeThere are only 2 genders, and if you disagree then you're an Islamophobe. Leftist SJWs BTFO!Mirror, Mirror on THE WALL, who's the WOKEST of us ALL??Friday, June 8th:TODAY'S ACTION:President Donald J. Trump Proclaims June 14, 2018 as Flag Day and the Week Starting June 10, 2018 as National Flag WeekPresident Trump Delivers a Statement Upon DeparturePresident Trump Participates in an Expanded Bilateral Meeting with the Prime Minister of CanadaPresident Trump Participates in a Bilateral Meeting with the President of the French Republic🔥🔥TRUMP TWEETS🔥🔥:Obama, Schumer and Pelosi did NOTHING about North Korea, and now weak on Crime, High Tax Schumer is telling me what to do at the Summit the Dems could never set up. Schumer failed with North Korea and Iran, we don’t need his advice!Canada charges the U.S. a 270% tariff on Dairy Products! They didn’t tell you that, did they? Not fair to our farmers!Looking forward to straightening out unfair Trade Deals with the G-7 countries. If it doesn’t happen, we come out even better!Congratulations to the Washington Capitals on their GREAT play and winning the Stanley Cup Championship. Alex Ovechkin, the team captain, was spectacular - a true Superstar! D.C. is popping, in many ways. What a time!I am heading for Canada and the G-7 for talks that will mostly center on the long time unfair trade practiced against the United States. From there I go to Singapore and talks with North Korea on Denuclearization. Won’t be talking about the Russian Witch Hunt Hoax for a while!My thoughts and prayers are with the families of our serviceman who was killed and his fellow servicemen who were wounded in Somalia. They are truly all HEROES.(Retweeting G7 Canada) Day 1 of #G7Charlevoix in 60 seconds.SIGNIFICANT TWEETS AND NEWS:President Trump confirms intent to sign states' rights cannabis bill that was introduced in Congress yesterdayPewdiepie reuploads video exposing CNN and Hillary Clinton after it got copystriked and deleted!BAHAHAHAHAHA.............BAHAJSJSKGLGOGICSteam refuses to bend the knee to SJWs, choosing to stand with community - All content that is legal will be allowed.BREAKING: Trump tells kneeling NFL players to recommend people to pardon, since that's what they're supposedly protesting. Their reason to kneel just died. LOL🐸 TOP SPICE OF THE DAY 🐸:When you're surrounded by globalistsPresstitutesHookers for Hillary, I should have known...ARCHIVE: "Sleeping with your source- especially a vindictive congressman?" - Ali Watkins, 2013Saturday, June 10th:TODAY'S ACTION:President Trump delivers a statementSIGNIFICANT TWEETS AND NEWS:Ali Watkins not getting the probe she had hoped for; Feds have seized her email and phone records for investigation on James Wolfe!HOLY SHIT Last night Bill Maher said what every lefitist truly thinks but might not say out loud: That he HOPES FOR A RECESSION to hurt President Trump. They'd rather see our country fail if it means Trump won't succeed. This is peak Trump derangement, folks. SAD!James Wolfe Leak Investigation: Journalists Insist on a Double Standard - Andrew McCarthyNew italian PM Conte on Facebook: Historic alliance, new friendship 🤝 - Can't get tired of all this winning, MAGA and MIGA!!! 🍝🍔BREAKING: Seth Rich's Brother's Attorneys Subpoena Twitter to Turn Over All Direct Messages from: Wikileaks, Julian Assange, KimDotCom, Cassandra Fairbanks, Gateway Pundit, etc🐸 TOP SPICE OF THE DAY 🐸:The God Emperor and his court JesterUSA and Canada 🇺🇲🇨🇦Not a drill: European Union banning memes (seriously).Dressed up for me best friend Melania.So Much Winning, STILL NOT TIRED OF IT!!As always, some tunes to get you jamming through this long list of winning;Ghost Town4th DimensionNo MistakesWatchWhat Would Meek do?MAGA ON PATRIOTS!Submitted June 09, 2018 at 11:48AM by Ivaginaryfriend https://www.reddit.com/The\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_Donald/comments/8ptnk6/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /The_DonaldSubmitted June 09, 2018 at 12:48PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pu2ln/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pun4d/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 06:13PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pwc8s/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 07:13PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pwpq2/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 08:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pxdfj/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 10:18PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pxu3a/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 09, 2018 at 11:58PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pydsj/afternoon\\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 12:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pynsafternoon\\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 02:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pz72afternoon\\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 03:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8pzfe1/afternoon\\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 06:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q02kv/afternoon\\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 08:43AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q0jrp/afternoon\\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 09:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q0s8t/afternoon\\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 10:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q1bf2/afternoon\\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 12:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q1y1t/afternoon\\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q2m9o/afternoon\\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 05:28PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q41fu/afternoon\\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 06:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q4hwafternoon\\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\\_your\\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 08:23PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q57mj/afternoon\\\\\\\\\\\\\_magathread\\\\\\\\\\\\\_your\\\\\\\\\\\\\_weekly\\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 09:28PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q5lxs/afternoon\\\\\\\\\\\\_magathread\\\\\\\\\\\\_your\\\\\\\\\\\\_weekly\\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 10, 2018 at 11:48PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q6hj6/afternoon\\\\\\\\\\\_magathread\\\\\\\\\\\_your\\\\\\\\\\\_weekly\\\\\\\\\\\_presidential/?utm\\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 12:18AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q6o1m/afternoon\\\\\\\\\\_magathread\\\\\\\\\\_your\\\\\\\\\\_weekly\\\\\\\\\\_presidential/?utm\\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 01:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q71kt/afternoon\\\\\\\\\_magathread\\\\\\\\\_your\\\\\\\\\_weekly\\\\\\\\\_presidential/?utm\\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 02:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q7hym/afternoon\\\\\\\\_magathread\\\\\\\\_your\\\\\\\\_weekly\\\\\\\\_presidential/?utm\\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 03:58AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q7sgi/afternoon\\\\\\\_magathread\\\\\\\_your\\\\\\\_weekly\\\\\\\_presidential/?utm\\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 06:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q8lkv/afternoon\\\\\\_magathread\\\\\\_your\\\\\\_weekly\\\\\\_presidential/?utm\\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 08:23AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q93tt/afternoon\\\\\_magathread\\\\\_your\\\\\_weekly\\\\\_presidential/?utm\\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 09:28AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8q9iv4/afternoon\\\\_magathread\\\\_your\\\\_weekly\\\\_presidential/?utm\\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 10:53AM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qa4xafternoon\\\_magathread\\\_your\\\_weekly\\\_presidential/?utm\\\_source=iftttvia /MagaFirstNewsSubmitted June 11, 2018 at 12:33PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qavpx/afternoon\\_magathread\\_your\\_weekly\\_presidential/?utm\\_source=iftttvia /MagaFirstNews
Submitted June 11, 2018 at 02:08PM by peterboykin https://www.reddit.com/MagaFirstNews/comments/8qbjwj/afternoon\_magathread\_your\_weekly\_presidential/?utm\_source=ifttt
via /MagaFirstNews
submitted by peterboykin to MagaFirstNews [link] [comments]